SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g13420.1|PACid:21900682 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os07g13420.1|PACid:21900682
Domain Number 1 Region: 554-983
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.89e-173
Family Reverse transcriptase 0.0000162
Further Details:      
 
Domain Number 2 Region: 1155-1314
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.45e-45
Family Retroviral integrase, catalytic domain 0.011
Further Details:      
 
Domain Number 3 Region: 394-501
Classification Level Classification E-value
Superfamily Acid proteases 4.5e-18
Family Retroviral protease (retropepsin) 0.023
Further Details:      
 
Domain Number 4 Region: 345-382
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000209
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g13420.1|PACid:21900682
Sequence length 1514
Sequence
MEIRNGSRDSNNASGSEELINGACANSASDNSPSPPPENPTIAQVLDNQTQMMTVMMQQM
QQQYHQVLQQVQQQAQQQQQNLQFGPPPPQSKLLEFLRVKPPTFSSTTNPIEAHDWLHAI
EKKLNLLQCNEQEKVAFATHQLQGPASVWWDNYMVTRPTGAEVTWTEFCHSFNKAQVPEG
IVAQKKREFRSLQQGTRTVIEYLHEFNRLARYAPEDVRTDDGRREKFLSGLDDELTNQLI
SRDYEDFEKLVDKAIRQEEHCNKINRKRKTAQFRTPQGKSQKPRFTMGHHGGPSTMIIRQ
HRPYHPGSFNKNHHSGSHNNSEQHSLNPTPSSLKIPAQSVQPALPEQPKRLGEKPELCFN
CNKPGHTVGKCPKPRRAGPKFVQARVTHASAEEAQSAPEVILGTFPVNSTPAVILFDSGA
THSFISKRFAGAHGLSLVKLKIPMRVHTPGGGMTTTHYCPSVTVEIQGLIFPANLILLES
KDLDVILGMDWLTRHRGVIDCASRTIKLTNAKGEVVTFQSLVPQKPGISLNQAAGEEQEV
AVEKTTKKLEDIPIVREYPKVFPDDLTTMPPKRDIEFRIDLVPGTAPIHKRPYRMGANEL
AEVKKQVDEQLQKGYIHPSTSPWGAPVIFVEKKDKTKRMCVDYRAFNEVTIKNKYPLPRI
DDLFDQLKGATVFSKIDLRSGYHQLRIHEEDIPKTAFITRYGLFECTVMSFGLTNTPAFF
MNLMNKVFMKFLDKFVVVFIDDILIYSKSEEEHEQHLRLVLEKLKEHQLYAKFSKCDFWL
KEVQFLGHIVNAQGVAMDPANVESVTKWTPPRTVTQVRSFLGLAGYYRRFIENFSKIAKP
MTQLLKKEEKFIWSAKCNRSFEELKRRLVSAPVLILPDQTKDFQVYCDASRQGLGCVLMQ
DGKVVSYASRQLRPHEGNYPTHDLELAAVVHALKIWRHYLIGNRCEVYTDHKSLKYIFTQ
PDLNLRQRRWLELIKDYDMGIHYHPGKANVVADALSRKSYCNVAWVEQLCCEVQRDLEHL
NLGIVEHGFVVALEAQPTLVEQVRIAQASDPEVAELKKNMRVGKARGFVEDEQGTIWMGE
RLCVPENKELKDLILTEAHQTQYSILSGSTKMYQDLKEKFWWVSMRREIAEFVALCDVCQ
RVKAEHQRPAGLLQPLQIPEWKWEEIGMDFITGLPRTSSGHDSIWVVVDRLTKVAHFIPV
HTTYSGKKLAELYLARIMCLHGVPKKIVSDRGSQFTSKFWQKLQEELGTRLNFSTAYHPQ
TDGQTERVNQILEDMLRACALDFGGAWDKSLPYAEFSYNNSYQASLQMAPFEALYGRRCR
TPLFWDQTGERQLFGTEVLNEAEEKVRAVRERLRIAQSRQKSYADNRRRELAFETGDYVY
LRVTPLRGVHRFQTKGKLAPRFVGPYRILERRGEVAYQLELPSNMLGIHNVFHVSQLKKC
LRVPEEQASPDHIEIQEDLTYVEKPTRILETSERRTRNKVIRFCKVQWSHHSEEEATHPH
LFASSSESRGRDSV
Download sequence
Identical sequences LOC_Os07g13420.1|13107.m01394|protein 39947.LOC_Os07g13420.1 LOC_Os07g13420.1|PACid:21900682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]