SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g16240.1|PACid:21900355 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os07g16240.1|PACid:21900355
Domain Number 1 Region: 297-726
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.67e-175
Family Reverse transcriptase 0.0000174
Further Details:      
 
Domain Number 2 Region: 899-1059
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.66e-42
Family Retroviral integrase, catalytic domain 0.012
Further Details:      
 
Domain Number 3 Region: 154-258
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000433
Family Retroviral protease (retropepsin) 0.035
Further Details:      
 
Domain Number 4 Region: 89-125
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000297
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Weak hits

Sequence:  LOC_Os07g16240.1|PACid:21900355
Domain Number - Region: 1170-1243
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0275
Family Chromo domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g16240.1|PACid:21900355
Sequence length 1243
Sequence
MTGDYHDFQKLVDKAIRQEDKYNCMEQKKRRIAHFKAQQGNSQRPRLTLGPQSMPQGGSS
SVVCPQRQFFNNNAGNNIRNQAPRPVATPTQQQPAKREQGSKPGVCFNCGDSGHYSDKCP
KPRRVKVVPAQSNSTAPAPKARVNHVAAAEARGAPDVILGTFLVNSVPATVLFDSGATHS
FLSMSFAGNHGMEVEDLRCPLMVSTPSNQALSLQRSPSVRIEIQEVPFLANLILLESKDL
DVILGMDWLARYKGVIDCANRKVTLTSNDGRVVTVHALSSESLRSSLNQMTLQEISIVRE
YPDVFPDDLPGMPPKTDIEFRIDLVPGTTPIHKRPYRMAANELAQVKRQVDDLLQKGYIR
PSSSPWGAPVIFVEKKDHTQRMCVDYRALNDVTIKNKYPLPRIDDLFDQLKGATVFSKID
LRSGYHQLRIKEEDIPKTAFITRYGLFECTVMSFGLTNAPAFFMNLMNKVFMEYLDKFVV
VFIDDILIYSRTKEEHEEHLRLALEKLREHQLYAKFSKCEFWLSEVKFLGHVISAGGVAV
DPSNVESVTNWKQPKTVSEIRSFLGLAGYYRRFIENFSKIAKSMTRLLQKDVKYKWSEEC
EQSFQELKNRLISAPILILPDPKKGFQVYCDASKLGLGCVLMQDGKVVAYASRQLHPHEK
NYPTHDLELASVVHALKIWRHYLFGTHTEVYTDHKSLKYIFTQPDLNMRQRRWLELIKDY
DMGIHYHPGKANVVADALSRKGYCNATEGRQLPLELCKEFERLNLGIVSRGFVAALEAKP
TLIDQVREAQINDPDIQEIKKNMRRGKAIGFLEDEQGTVWLGERICVPDNKDLKDAILKE
AHDTLYSIHPGSTKMYQDLKERFWWASMKREIAEYVTVCDVCQRVKAEHQKPAGLLQPLK
IPEWKWEEIGMDFITGLPRTSSGHDSIWVIVDRLTKVAHFIPVKTTYSGSRLTELYMARI
VCLHGVPKKIVSDRGSQFTSKFWKKLQEEMGSKLNFSTAYHLQTDGQTERVNQILEDMLR
ACALDFGGSWDKNLPYAKFSYNNSYQASLQMAPYEALYCRKCRTPLLWDQTGERQVFGTD
ILREAEKKVKIIQERLRVAQSRHKSYADNRRRDLSFEEGDYVYLRVTPLRGVHRFHTKGK
LAPRFGGPYKIVSRRGEVAYQLELPQSLAGVHNVFHVSQFKKCFRVPTEEVNLEQIEVQE
AGLTYVEKPIRILEIDERRTRNRVIRFCKVQWSNHSEEESTWE
Download sequence
Identical sequences 39947.LOC_Os07g16240.1 LOC_Os07g16240.1|13107.m01696|protein LOC_Os07g16240.1|PACid:21900355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]