SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g28510.1|PACid:21898220 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os07g28510.1|PACid:21898220
Domain Number 1 Region: 780-1209
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.34e-174
Family Reverse transcriptase 0.0000131
Further Details:      
 
Domain Number 2 Region: 1381-1541
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.52e-44
Family Retroviral integrase, catalytic domain 0.011
Further Details:      
 
Domain Number 3 Region: 621-727
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000156
Family Retroviral protease (retropepsin) 0.05
Further Details:      
 
Domain Number 4 Region: 566-607
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000733
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g28510.1|PACid:21898220
Sequence length 1707
Sequence
MAGHPPNHHGEGMIDFVAELARMTLVVGYPNAPEYTTIPPLSGELPHRVRLEVHDYVGTC
LANMVVEASGGSADHACQEAAYLMMARIRERHNYIFHDTAYRFHLVEPVMMMMHSDLHKA
TKALNDGKLMRIVALKDEIARLKRENAQLKGLPAPGGVRIRTTPRKTTTAPVRIQLAPRN
PPPSAAPAAPPVPPVVPAAPAPAPASALSFAPASAARGPASGTGGCFFGMVYTRNGSRAT
GEGSNGEERTDGAHPHSDSGNGPPPLPENPTLAQVMAHQTQMMAAMMQQMQQQHQQMHQR
MLQHAEQQHQQFGPPPPQSKLPEFLRVRPPTFSSTTNPMEANDWLHAIEKKLNLLQCNDQ
EKVAFATHQLQGPASAWWDNHMTTRPPGIEVTWAEFCRSFRKAQVPDGVVAQKKREFRAL
HQGNRTVTEYLHEFNRLARYAPEDVRTDAEKQEKFMAGLDDELTNQLISGDYADFERLVD
KAIRQEDQRNKMDRKRKAAQFRAPQGSHQRSRFAPGQQGGPTTMIVRQHRPFNPSNFPQG
TSGSQNHHGGQSNRGAAPRPPMAPAQSGPPAQAKKETGAKPGSCFNCGELGHFADKCPKP
RRAGPRFIQARVNHASAEEAQAAPEVILGTFPINSIPAIVLFDSGATHYFISKKFVGMQG
LIREELSTPMRVHTPGNSSTSVQFSPSITIEIQRSPFLANLILLESKDLDVILGMDWLTK
FKGVIDCANRTVTLTNEKGETVVYKSPDSPKQGVSLNQIETEIPVDTVEKNLRKLEDIPI
VCEYPEVFPEDLTTMPPKREIEFRIDLAPGTAPIYKRPYRMAANELAEVKKQVDEQLQKG
YIRPSTSPWGAPVIFVEKKDKTKRMCVDYRALNEVTIKNKYPLPQIDDLFDQLKGAKVFS
KIDLRSGYHQLRIREEDIPKTAFTTRYGLYECTVISFRLTNAPAFFMNLMNKVFMEFLDK
FVVVFIDDILIYSKSEEEHEQHLRLVLEKLKEHQLYAKFSKCDFWLTEVKFLGHVITAQG
VVVDPSNVESVTKWTPPKTVSQIRSFLGLAGYYRRFIENFSRIARPMTQLLKKDEKFKWT
AECDKSFEELKKKLVSAPVLILPDQMKDFKVYCDASRHGLGCVLMQEGRVVAYASRQLRP
HEGNYPTHDLELAAVVHALKIWRHYLIGNRCEVYTDHKSLKYIFTQPDLNLRQRRWLELI
KDYDMSIHYHPGKANVVADALSRKSYCTALCIEGMCEELRQEFEHLNMGIVEHGFVAALE
ARPTLVDQVRAAQVNDSEIAELKKNMRVGKARDFHEDEHGTIWLGERLCVPDDKELKDLI
LTEAHQTQYSIHPGSTKMYQDLKEKFWWVSMRREIAEFVALCDVCQRVKAEHQRPAGLLQ
PLQIPEWKWEEIGMDFITGLPRTSSGHDSIWVVVDRLTKVAHFIPVHTTYTGKRLAELYL
SRIMCLHGVPKKIVSDRGSQFTSKFWQKLQEELGTRLNFSTAYHPQTDGQTERVNQIMED
MLRACAVDFGGAWDKSLPYAEFSYNNSYQASLQMAPFEALYGQKCRTPLFWDQTGERQLF
GTEVLAEAEEKVRIIRERLRIAQSRQKSYADNRRRELTFEAGDYVYLRVTPLRGVHRFQT
KGKLAPCFVGPYKILERRGEVAYQLELPSNMIGIHDVFHVSQLKKCLRVPEEQADSEHID
IQEDLTYVEKPVRILDTSERRTRNKVT
Download sequence
Identical sequences LOC_Os07g28510.1|PACid:21898220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]