SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g30840.3|PACid:21901062 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os07g30840.3|PACid:21901062
Domain Number - Region: 185-233
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0195
Family IMD domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g30840.3|PACid:21901062
Sequence length 249
Sequence
MAMDAERRQAELIEQFSAQAAALSSSAPQLAALVLEATSHPALFAFSELLSLPALSKLTG
TQYASSLDVLRLFAYGTLKDYKSNSGNLPALLPDQVRKLKQLSVLTLAESTKVLPYDQLM
QELDVSNVRELEDFLINECMYSGIVRGKLDQLRRCFEVQFATGRDLTPDQLNNMIDTLSD
WLGTSDNLLHQIQEKIKWADTMSEVNKKHQKEFEDKVEEAKKSIKKLNNLSRQTSTYGGM
TTFSLNLEE
Download sequence
Identical sequences XP_015644834.1.37577 LOC_Os07g30840.3|PACid:21901062 LOC_Os07g30840.3|13107.m03111|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]