SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g40270.1|PACid:21900636 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os07g40270.1|PACid:21900636
Domain Number - Region: 25-198
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0502
Family FCH domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g40270.1|PACid:21900636
Sequence length 608
Sequence
MATEDTSHISGSSESTIPLLEQLAEVFGKLKSHTETSLQLQNGINWEDIKAHFLNLEKSY
KSKCDELAEKQKALEEKKAESCRLIAEKEANVSAKERAFLNQFQELRDTAVSALSEVRQK
YKVELAGILDANGSKDKKVRTSTNDMNALCASEENTTASGLGEPSEASPVDVKPRPVLKQ
LCEQMDTAGLLKFLSENWKKLSSLRDELSAALRCATDPARFVLGSLEGFFPSDHTSSPGN
KQIILQGQRRSCIILMEAITPALATKEPGDNHPWSSEIRELAKAIAEEWKSKLAEVDLDA
SDGYSLEAQAFLQLLTTFNVDSVLDEDELCKLVVAVSRRKQTAELCRSLCLNERIPDIIK
ELVNRHRQIDAVQFIHAFGLSESFPPAPLLKTYVEELKDSLGNNGDGNAASLKDDPKTRE
LLALRAVIKCIEEYKLQKDYPLGPLQKRVAELKSKGEKRPLEAGRHNAKKPRTFGNSAAR
RPPNPVGSAGRRPSGPAGTWQRPPPPMPSYPDRYGHADRYHYTAPSATYDPPAYASYSEP
YSASKPYQYTPGSVAPASYNSNQFKVAYGGPGAPPTAGGYGSYNDAAGQSTSSSYSGYSG
YHPSLPRL
Download sequence
Identical sequences I1QBV3 Q7XIP0
LOC_Os07g40270.1|PACid:21900636 LOC_Os07g40270.1|13107.m04185|protein XP_015647752.1.37577 ORGLA07G0159500.1 39947.LOC_Os07g40270.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]