SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g11800.1|PACid:21888669 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g11800.1|PACid:21888669
Domain Number 1 Region: 680-1109
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.22e-177
Family Reverse transcriptase 0.0000175
Further Details:      
 
Domain Number 2 Region: 1282-1438
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.64e-42
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 
Domain Number 3 Region: 535-641
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000139
Family Retroviral protease (retropepsin) 0.056
Further Details:      
 
Domain Number 4 Region: 470-508
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000349
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g11800.1|PACid:21888669
Sequence length 1623
Sequence
MSFVISLTLLTIIEDAITGNNLMSSWFGMMPRYKPEYLFGVEGFVQELRTMSFVIGFGTA
PFYAQIPHDRHEEKCRVKVTLNSNSEDIPSVMFEAGGRNYIQACQEGSDRGSYLETEGIE
NDATTRHLVVMLWAMDERRAETVLAAQDREDWNRGKICKLEDKVDRLEKELAALKGEAPP
QKARIRLTARKRALFVPRYQLAPKFRVVEKEVTPALADPPVVNMVNTRSNGNGPNNNNNN
NNNNEGNPTLAQVLAQQTQLMNMMMQQLQNQQNQGNNHAPPQNKLAEFLRVRPPTFSSTT
NPVEAGDWLHAIEKKLDLLQCTDQEKVSFASHQLHGPASEWWDHFRLNRTTAESITWLEF
TAAFRKTHIPSGVVSLKKKEFRSLTQGSRSVTEYLHEFNRQARYAPEDVRNDEERQEKFL
EGLNDELSYPLMTGDYSDFQKLVDKAIRQEDKYNRMEQKKRRIAQFKTQQAPTQQQPAKR
EQGSKPVMCFNCGDPGHYADKCPKPRRVKVVPAQSNSTVPASKARVNHVATAEAQDAPDV
ILGTFPVNSVHATVLFDSGATHSFLSMSFAGNHGMEVEDLRRPLMVSTPSNQALSLQHSP
SVRIEIQGVPFLANLILLESKDLDVILGMDWLARHKGVIDCANRKVTLTSDDGRVVTVHA
LSSESLRSRLNQITLEEIPIVREYSDVFPDDLPGMPPKKDIEFKIDLVPGTTPIHKRPYR
MAANELAEVKRQVDDLLQKGYIRPSSSPWGAPVIFVEKKDHTQRMCVDYRALNDVTIKNK
YPLPRIDDLFDQLKGATVFSKIDLRSGYHQLRIKEEDIPKTAFTTRYGLFECTVMSFGLT
NAPAFFMNLMNKVFMEYLDKFVVIFIDDILIYSRTKEEHEEHLRLALEKLREHQLYAKFS
KCEFWLSEVKFLGHVISAGGVAVDPSNVESVTNWKQPKTVSEIRSFLGLAGYYRRFIENF
SKIAKPMTRLLQKDVKYKWSEECEQSFQELKGRLISAPILMLPDPKKGFQVYCDASKLGL
GCVLMQDGKVVAYASRQLRPHEKNYPTHDLELAAVVHALKIWRHYLFGTRTEVYTDHKSL
KYIFTQSDLNMRQRRWLELIKDYDMGIHYYPGKANVVADALSRKGYCNATKGRQLPLELC
KEFERLNLGIVSRGFVAALEAKPTLIDQVREAQINDPDIQEIKKNMRRGKAIGFLEDEQG
TVWLGERICVPDNKDLKDAILKEAHDTLYSIHPGSTKMYQDLKERFWWASMKREIAEYVV
VCDVCQRVKAEHQKPAGLLQPLKIPEWKWEEIGMDFITGLPRTSSGHDSIWVIVDRLTKV
AHFIPVKTTYSGSRLAELYMARIVCLHGVPKKIVSDRGSQFTSNFWKKLQEEMGSKLNFS
TAYHPQTDGQTERVNQILEDMLRACALDFGGSWDKNLPYAEFSYNNSYQASLQMASYEAL
YGRKCRTPLLWDQTGERQVFGTDILREAEEKVKIIQERLRVVQSRHKSYADNRRRDLSFE
EGDYVYLRVTPLRGVHRFHTKGKLAPRFVGPYKIVSRRGEVAYQLELPQSLAGVHNVFHV
LQLKKCLRVPTEEANLEQIEVQEDLTYVEKPIRILETNYRRTKNRVIRFCKVQWTNHSEE
EST
Download sequence
Identical sequences LOC_Os08g11800.1|PACid:21888669 39947.LOC_Os08g11800.1 LOC_Os08g11800.1|13108.m01259|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]