SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g12080.1|PACid:21890729 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g12080.1|PACid:21890729
Domain Number 1 Region: 738-1075
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.56e-121
Family Reverse transcriptase 0.00019
Further Details:      
 
Domain Number 2 Region: 1247-1407
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.43e-42
Family Retroviral integrase, catalytic domain 0.014
Further Details:      
 
Domain Number 3 Region: 594-698
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000238
Family Retroviral protease (retropepsin) 0.028
Further Details:      
 
Domain Number 4 Region: 531-567
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000753
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Weak hits

Sequence:  LOC_Os08g12080.1|PACid:21890729
Domain Number - Region: 257-266,365-370
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000288
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g12080.1|PACid:21890729
Sequence length 1616
Sequence
MAGGGGIRGGGGARARARRRERPEEGDDGWAPPMAGSINRRGLDLTGFVLELRGMCVVQG
YPHGVDYQGKQLSKQEGDDAEPHAAWEVTAVILTGSPERTSLAVTAGGDSFSAACQNAAL
LAIGTLHQRYPDELQHSPYRYHPRRGGARDCATFRDASSEDDATIMHLARMVEAYDAACI
DFHQMVRRGLVENNMKILEQRQENLQLKKDLDAVEVLLCQLKIAQGEMVTTRRSAATGEG
SHPEGSNHNNHGSPPQPPPPPPPPPPDTNSILTQILTQQANMMAAFLHHIQNPPQHNAPP
PPPPPQHSKLAEFLRIRPPTFSSSNNPVDALDWLHAVGKKLDTVQCNDEEKVIFAAHQLQ
GPASLWWDHFQATQPEGQPITWARFTAAFRRTHVPAGVMALKKREFRELKQGNCYVMEYL
HEFNNLARYAPEDVREDEEKQEKFLAGMDPELSVRLVSGDYPDFQCLVDKSIRLEAKHKE
LESHKRRLANFRNQQGANQRVRYTNPYPGGSSSQQQQQQQPRSAPQPQFVPGQGRRDAQG
LQRLCFNCFEPGHFADKCPKPRRLQGQAPPRPNNGGKDVIRGRVNHVTAEDVLTTPDVIV
GTFLIHSIPATILFDSGASHSFIYVPFVGRNQLGVERLRNPLLITTPGGVMTAKYYSPAI
PIEIQGIPFPSNLILLDTKNLDVILGMNWLAQFQGVVDCARRTVTLYRGPEQPVVFFAPS
TSVGSSELHQIGLSETPIVREFGDVFPEELRGMPPKREIEFRIDLAPGTTPLYKRPYRMV
ANELAEVKKQLEELKEKGYIRPSTSPWGAPVIFVEKKDKTKRMCVAYRALNELRIREEDI
PKTAFTTRYGLYELTVMSFGLTNAPAFFMNLMNKVKFLGHVISAKGVAMDPETVTAVTDW
KQPKTVTQIRSFLGLAGYYRRFIENFSKIARPMTQLLKKEEKFVWSPQCEKAFKTLKEKL
VSSPVLILPDTRKDFMVYCDALRQGLGCVLMQEGHVVAYASRQLRPHEGNYPTHDLELAV
VVHALKIWRHYLIGNRCEIYTDHKSLKYIFTQSDLNLRQRRWLELIKDYDVGIHYHPGKA
NVVADALSRKSHCNTLNVRGIPPELNQQMEALNLSIVGRGFLAALEAKPTLLDQIREAQK
NDPDMRGLLKNMKQGKAAGFTEDEHGTLWNGNRVCVPDDRELKQLILQEAHESPYSIHPG
STKMYLDLKEKYWWVSMKREIAEFVALCDVCQRVKAEHQRPAGLLQPLQVPEWKWDEIGM
DFITGLPKTQGGYDSIWVVVDRLTKVARFIPVKTTYGGNKLAELYFARIVSLHGVPKKIV
SDRGSQFTSYFWKKLQEELGTRLNFSTAYHPQTDGQTERLNQILEDMLRACVLDFGKTWD
KSLPYTEFSYNNSYQASIQMAPYEALYGRKCRTPLLWDQVGESQVFGTDILREAEAKVRT
IRDNLKVAQSRQKSYADNRRRNLEFAVDDFVYLRVTPLRGVDRFQTKGKLAPRFVGPFRI
IARRGEVAYQLELPASLGNVHDVFHVSQLKKCLRVPSEQTDPEQIEVREDLTYEERPVKI
LDTMERRTRNRVIHFCKVQWSNHAEEEATREREEKLKAAHPDLFASSSESRGRDSV
Download sequence
Identical sequences LOC_Os08g12080.1|PACid:21890729 39947.LOC_Os08g12080.1 LOC_Os08g12080.1|13108.m01287|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]