SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g20170.1|PACid:21889762 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g20170.1|PACid:21889762
Domain Number 1 Region: 670-1066
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.22e-153
Family Reverse transcriptase 0.0000515
Further Details:      
 
Domain Number 2 Region: 1237-1349
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.69e-30
Family Retroviral integrase, catalytic domain 0.011
Further Details:      
 
Domain Number 3 Region: 511-617
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000996
Family Retroviral protease (retropepsin) 0.033
Further Details:      
 
Domain Number 4 Region: 452-496
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000523
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 
Weak hits

Sequence:  LOC_Os08g20170.1|PACid:21889762
Domain Number - Region: 1462-1540
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000907
Family Chromo domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g20170.1|PACid:21889762
Sequence length 1558
Sequence
MADHPPNHREEGMDDFVAELARMTMVVGYHNAPEYSTVPPLSGELPYRVRLEVHGYVGTC
LANMVVEASGGTADHACQEAAYLMMARLRERHNYIFCNTAYRFHPRRASGGGVSTFRPTA
GENDTTFGHMCAVMRGMDRMHSDMHKASKALNDGKLVRIIALKDEIARLKKENAQLKGLP
IPGGVRIRTTPRKSMTAPVRIQLAPRNPPPPAAPAAPLVPPAVPAAPAAPAPVPAPVPVS
APCVRSLLRSSISRQGSSQWQWRLVACYSQWQPRPQQQQFSGSESGSGETFVRLWMVNTR
NGSRAVGEGSNGEERTNGGHPNSASGNGPPPLPENPTLAQVRRSLRQSSIVALGRRRCPT
GSWHKRREFRALHQGNRTVTEYLHEFNRLARYAPEDARTDAEKQEKFLAGLDDELTNQLI
SGDYADFEKLVDKAIRKEDQRNKMDGKRKAAQFRSNQGTPSAQAKETGAKPGSCFNCGEH
GHFADKCPKPRRARPRFSQARVNHASAEEAQAAPEVILGTFPVNLVPATVLFDSGATHCF
ISKKFVGMHGLRKEELSTPMRVHTPGNSSTSVSYSPSVLIEIHRSQFLANLILLESKDLD
VILGMDWLTKFKGVIDCANRTVTLTNEKGETVVYKSLVSPKQRISLNQIEVEIPVTTEEK
SSRKLEDIPIVCEYPEVFPEDLTSMPPKREIEFRIDLAPGTAPIYKRPYRMAANELAEVK
KQVDEQLQKGYIRPSTSPWGAPVIFVEKKDKTKRICVDYRALNEVTIKNKYSLPRIDDLF
HQLKGAKVFSKIDLQSGYHQLRIREENIPKTAFTTRYGLYECTVMSFGLTNAPAFFMNLM
NKVFMEFLDKFVVVFIDDILIYSKSEEEHERHLCLVLEKLKEHQLYAKFSKCDFWLSEVK
FLGHVITAQGVAVDPSNVESVTKWTPPKTVSQIRSFLGLCDKSFEELKKKLVSAPVLILP
DQTKDFQVYCDASRHGLGCVLMQEGRVVAYASRQLRPHEGNYPTHDLELAAVVHALKIWR
HYLIGNRCKVYTDYKSLKYIFTQPDLNLRQRRWLELIKDYDMSIHYHPGKANVVADALSR
KSYCNALCTEGMCKELQQELEHLNLGLVEYGYVAALEARLTLVDQVGVAQVNDPEIAKLK
KNMRVGKARDFHEDEHGTIWLGERWCVPDDKELKDLILIEAHQTQYSIHPGSTKMYQDLK
EKFCWVSMRREIAEFVALCDVCQRVKAEHQRPAVHTTYTGKKLAELYLARIMCLHGVPKK
IVSDRGSQFTSKFWQKLQEELGTRLNFSTAYHPQTDDQTERVNQILEDMLRACALDFGGA
WDKSLPYAEFSYNNSYQASLQMAPFEALFGRKCRTPLFWDQTGERQLFGTEVLMEAEEKV
RTVRERLRVAQSQQKSYADNRRRELTFEAGDYVYLRVTPLRGVHSFQTKGKLALRFVGPY
KILERRGEVAYQLELPSNMIGNHDVFHVPQLKKCLRVPEEQADSEHIDIQEDLTYVEKPV
RILETNERRTRNKVTRFCRVQWSHHSKEEATWEREGELKAAHPHLFTSSSESRGRDSV
Download sequence
Identical sequences LOC_Os08g20170.1|PACid:21889762 LOC_Os08g20170.1|13108.m02103|protein 39947.LOC_Os08g20170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]