SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g20770.1|PACid:21889752 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g20770.1|PACid:21889752
Domain Number 1 Region: 503-912
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.08e-166
Family Reverse transcriptase 0.0000224
Further Details:      
 
Domain Number 2 Region: 1020-1118
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.66e-16
Family Retroviral integrase, catalytic domain 0.021
Further Details:      
 
Domain Number 3 Region: 357-464
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000169
Family Retroviral protease (retropepsin) 0.037
Further Details:      
 
Domain Number 4 Region: 296-331
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000384
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g20770.1|PACid:21889752
Sequence length 1289
Sequence
MVNTRSNGNGPNNPNNNNNGENPTLAQVLAQQTQLMNMMMQQLQNQQNQGNNHAPPQNKL
AEFLRVRPPVFSSTTNPVEAGDWLHAIEKKLDLLQCTDQEKVSFASHQLHGSAFEWWDHF
RLNRTTAEPITWLEFTAAFRKTHIPSGVVSLKKKEFRSLTQGSRSVTEYLHEFNRLARYA
PEDVRNDEEHQEKFLGGLNDELSYPLMVGDYPDFQKLVDKAIRQEDKYNCMEQRKRRIAH
FKAQQGSNQKPRFTLGPQSMPQGGSSSVVRPQRQFFNNNAGNNIRNQAPRPVAAPTQQQP
AKREQGSKPVVCFNCGDPGHYADKCPKPRRVKVVPAQSNSAVPASKARVNHVAAAEAQDA
PDVILGTFPVNSVPATVLFDSGATHSFLSMSFAGNHGMEVEDLRHPLMVSTPRNQALSLQ
RSPSVRIEIKGVPFLANLILLESKDLDVILGMDWLARHRGVIDCANRKVTLTSNDGRVVT
VHALSSESLRSRLNQITLEEIPIVREYPDVFPDDLPGMPPKRDIEFRIDLVPGTTPIHKR
PYRMAANELAEVKRQVDDLLQKGYIRPSSSPWGAPVIFVEKKDHTQRMCVDYRALNDVTI
KNKYPLPRIDDLFDQLKGATIFSKIDLRSGYHQLRIKEEDIPKTAFTTRYGLFECTVMSF
GLTNAPAFFMNLMNKVFMEYLDKFVVVFIDDILIYSRTKEEHEEHLRLALEKLREHQLYA
KFSKCEFWLSEVKFLGHKQPKTVSEIRSFLGLAGYYRRFIENFSKIAKPMTRLLQKDVKY
KWSEECEQSFQELKSRLILAPILILPDPKKGFQVYCDASKLGLGCVLMQDGKVVAYASRQ
LRPHEKNYPTHDLELAAVVHALKIWRHYLFGTRTEVYTDHKSLKYIFTQPDLNMRQRRWL
ELIKDYDMGIHYHPGKANVVADALSRKGYCKATEGRQLPLELCKEFERLNLGIVNRGFVA
ALEAKPTLIDQVREAQINDPDIQEIKKNMRRGKAIGFLEDEQGTRVKAEHQKPAGLLQPL
KIPEWKWEEIGMDFITGLPRTSSGHDSIWVIVDRLTKVAHFIPTDGQTERVNQILEDMLR
ACALDFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTPLLWDQTGERQVFGTD
ILREAEEKVKIIQERLRVAQSHHKSYADNRCRDLSFEEGDYVYLRVTPFRGVHRFHTKGK
LAPRFVGPYKIVSRRGEVAYQLELPQSLAGVHNVFHVSQLKECLRVPTEEANLEQIEVQE
DLTYVEKPIRILETSERRTRNRVIRFCKV
Download sequence
Identical sequences Q6UU21
LOC_Os08g20770.1|13108.m02157|protein LOC_Os08g20770.1|PACid:21889752 39947.LOC_Os08g20770.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]