SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g34230.1|PACid:21889031 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g34230.1|PACid:21889031
Domain Number 1 Region: 364-394
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000879
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number 2 Region: 461-557
Classification Level Classification E-value
Superfamily Acid proteases 0.00000629
Family Retroviral protease (retropepsin) 0.045
Further Details:      
 
Weak hits

Sequence:  LOC_Os08g34230.1|PACid:21889031
Domain Number - Region: 10-74
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0167
Family FCH domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g34230.1|PACid:21889031
Sequence length 802
Sequence
MSGTSSDEPTLENLAHKLKGMENWYEELMRNSKSYNESTDKHLKTLSESLVKVVDQIEQM
NQSHKQLTENIQNMNIGHENIVRHIGLLEAAGEEGAGATAHRHQRYDDEDEEQSVADDEE
EDESVGNRRRRRVRDKDDPLSKVKFTKPSFDGKFEPSVYLDWELAVEQKFSCYDFPDNKK
VKAASSEFTSFTSLWWNDICGRGLRPRTWDDIKRTMRSRFVPSYYARDMLNKLHLLRQGS
NSVETYYQEMMIALSRCDLQETEDARISRFYGGLNREIRDILEYKEYNTMNRLFHFACKA
EREVQRRNKHRSSFAGATFTRQSTPRQSTTAVRPPTSTPPTSTPSHAQEPSKNASVQTPT
KSATSVASTGRTRDITCHRCHGIGHIARNCPNQRALFVNDDGEYTSASDCDDEYALAATD
HAGGQDNDDIEEVHLHPESLDQYPSLIVKLALSAKEKCEEQNQRHNLFQSKVLVKGHTIK
MIIDSGSCNNLASKEMVKNLGLTTYPHPHPYYIQWFNTCGKMKVTRLVKIPFSIGSYHDQ
IECDVVHMQACSVILGRLWQYDREVVFDGRTNTYKFMFDGKRVVLHSMTPAAALKDDLAR
LECEKKVKSDNQIIAKHLASTSKIEPSTTKNEIKLKGASLASKYNICALDEPDSCCYALF
CKDPILTFATAPSTLYSLPPTVTQEYENVFQDEIPPRMATRRESAHNQKDGIESRTTPIQ
EGEDDEDITSSDTLITSHVPMIIPSPSPARPPETVLTSNGPRVFMPTPIWVILDFVESLS
RYLSNTSSLMSKFISSQRESPK
Download sequence
Identical sequences 39947.LOC_Os08g34230.1 LOC_Os08g34230.1|13108.m03581|protein LOC_Os08g34230.1|PACid:21889031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]