SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os09g02110.1|PACid:21925110 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os09g02110.1|PACid:21925110
Domain Number 1 Region: 523-952
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3e-177
Family Reverse transcriptase 0.00001
Further Details:      
 
Domain Number 2 Region: 1124-1283
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.01e-45
Family Retroviral integrase, catalytic domain 0.011
Further Details:      
 
Domain Number 3 Region: 365-469
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000006
Family Retroviral protease (retropepsin) 0.034
Further Details:      
 
Domain Number 4 Region: 316-350
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000209
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os09g02110.1|PACid:21925110
Sequence length 1424
Sequence
MVKTRNDLRNSNDASGSEEQTDEAHTSGAPGSSSSPPPENPTVTQMMTMMMQQMQQHYHQ
MLQQAQQNQQFGPPPSHANDWLRAIEKKLNLLQCNDQEKVAFATHQLQGPASAWWDNYVV
TRPDATKVTWAEFCQNFRKAQIPEGIMAQQKREFRALQQGTRTVIEYLHEFNRLARYAPE
DVRSDTEKQEKFLFGLDDELTNQLISGVYEDFEKLVDKAIRQEEQRNKMDRKRKAAQISF
PQGNNQKPRFMMGQLGGPSTLIVCQHRPYHPSNFNNDYNGGSHNNRKQHNHNSTPPPLMA
PAQSDPPAVSAQSEQPKKGAVGKPGPCFNCGKHGHFASKCPKLNRTRPRFIQARANHVSA
EEAQAAPEVVLGTFPMNSYPATVLFDSGASHSFISKRFAGTHGLSVVELKIPMQVHTPGN
DMRTAHYCPSVTIEIKRSPFLSNLILLESKDLDVILGMDWLTRNKGVIDCASRTITLTND
KGEKITFRSPASQKPVASLNQAAIEGQTETVEKSPRKLEDIPIVQEYPEVFPEDLTTMPP
KREIEFRIDLVPGTAPIYKRPYRMAANELADVKKQVDEQLQKGYIRPSTSPWGAPVIFVE
KKDRTKRMCVDYRALNEVTIKNKYPLPRIDDLFDQLKGAKVFSKIDLRSGYHQLRIREED
IPKTAFTTRYGLFECTVMSFGLTNAPAFFMNLMNKVFMEFLDKFVVVFIDDILIYSKSEK
QHEQHLRLVLEKLKEHQLYAKFSKCDFWLSEVKFLGHIISAQGVAVDPSNVESVTKWTPP
KTVSQIRSFLGLAGYYRRFIENFSKIARPMTQLLKKDEKFKWSAECNQSFEELKNRLVSA
PVLILPDQTKDFQVYCDASRQGLGCVLMQEGRVVAYASRQLRPHETNYPTHDLELAAVVH
ALKIWRHYLIGNRCEVYTDHKSLKYIFTQPDLNLRQRRWLELIKDYDMGIHYHPGKANVV
ADALSRKSCCNALCPEDMCGKLQQDLEHLNLGIVEHGYVAALEARPTLVDQVRAAQENDP
EIAELKKNMRVGKARDFHEDEHGTIWLGERLCVPDDKELKDLILTEAHQTQYSIHPSSTK
MYQDLKEKFWWASMRREIAEFVALCDVCQRVKAEHQRPAGLLQPLQIPEWKWEEIGMDFI
TGLPRTSSGHDSIWVVVDRLTKVAHFIPVHTTYTGKRLAELYLARIMCLHGVPKKIVSDR
GSQFTSKFWQKLQEELGTRLNFSTAYHPQTDGQTERVNQILEDMLRACALDFGGAWDKSL
PYAEFSYNNSYQSSLQMAPFEALYGRKCRTPLFWDQTGERQLFGTEVLTEAEEKVRTVRE
RLRIAQSRQKSYADNRRRELTFEAGDYVYLRVTPLRGVHRFQTKGKLAPRFVGPYRILER
RGEVAYQLELPSNMVGIHDVFHVSQLKKCLRVPEEQASSEHIDI
Download sequence
Identical sequences LOC_Os09g02110.1|PACid:21925110 39947.LOC_Os09g02110.1 LOC_Os09g02110.1|13109.m00126|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]