SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os09g09400.1|PACid:21927263 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os09g09400.1|PACid:21927263
Domain Number 1 Region: 546-975
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.45e-173
Family Reverse transcriptase 0.00000983
Further Details:      
 
Domain Number 2 Region: 1147-1304
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.26e-42
Family Retroviral integrase, catalytic domain 0.016
Further Details:      
 
Domain Number 3 Region: 396-503
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000216
Family Retroviral protease (retropepsin) 0.03
Further Details:      
 
Domain Number 4 Region: 317-349
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000366
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Weak hits

Sequence:  LOC_Os09g09400.1|PACid:21927263
Domain Number - Region: 1418-1497
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00934
Family Chromo domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os09g09400.1|PACid:21927263
Sequence length 1504
Sequence
MTHTRSMAALTDDANGEGASQPRTGPYSSGRAGGSRRAATAEQHDDEPSLAQLLANQNRL
FERMVANSENMGAAMAQQANQAPSKLADVQRTHPPHFSSAADPLAADDWLRDIEIKLNLC
RCDPVEKATFAAYYLQGAAAAWWETYKTLIPPDEPITWTVFREGFRSAHIPAGLMEIKKK
EFLNLKQGNMPFMEFMERFNYLGRYAASDLNTETKKVELCRDRLAPELKHALAAHEITSM
KTLVALRVESSEKEVVEDRKRKWAAKKFAGSSSSTRPRLAPSPAVRPMAPQPPRQMYVPP
RPQTQLVRQVPRAVQAAGDASRNANVTCYNCGKKGHYSPSCPYPKTGTSGPYSQGAPQQP
RGPPQVQPGQRGAPAVPKPAPTFGRGRLNHVTAEEATDAPGVVLGTFLVHSIPLTVLFDS
GATHSFMSTLKAKQLDLKTEFLSDAMRIQSPGSTMVTKLLCKGVELIIDGVKFKANLILL
DTLGLDVILGMDWLTKHEGTIDCAHRTVTLRSTDGQFVRFTFEQTSTSNQPSIQSLSIPE
LKSVPIVNEYSDVFPDELPGMPPDRDIEFVIDLIPGTAPIAKRPYRMTSENLMELKKKLN
EQLAKGFIRPSSSPWGCPVLFVPKKDGTMRMCVDYRPLNEVTIKNKYPLPRIDDLFDQLT
GARVFSKIDLRLGYFQLKIRPEDIPKTAFTTRYGLFEYTVVSFGLTNAPASFMNMMNKIF
MEYLDKFVVVFIDDILIYSKSEEEHAQHLRMVLDKLREHQLYAKFSKCEFWLKEVEFLGH
VLSEGGIAVNPRNVQNVLNWKQPQNVPEIRSFLGLAGYYRRFIENFSKIARPLTQLLKKE
NKFIWSEACETSFHELKRRLTTAPVLVMPDVLKPFHVYCDASHHGLGCVLMQEGKVVAYA
SRQLRPHEINYPTHDLQLAAVVHALKIWRHYLVSNRCEIFTDHKSLKYFFTQPDLNLRQR
RWLELIKDYDLGIHYHPGKANVVADTLSRKLHHLAVIETINQPSLSSEFQKLNLGLVEDG
YVAALALQPTLYSQIKAAQSIDEEVAEIMKEINSKPQSIYTLNSDGMVMLGKRIFVPNNQ
HLRETILDEAHQTPLSIHPGCTKMYQDIRTQYWWPSLRRDIAAYVAICDVCQRVKAEHQR
PAGLLQPLQVPEWKFDEVGMDFITGLPKTPNGHDSIWVIMDRLTKVAHFIPVHVTYGGAK
LAELYLTHIVRLHGVPKVIVSDRGTQFTSRFWKNLHELLGTKLFLSTAFHPQTGGQVERT
NQILEDMLRACVLEHNTNWEKCLSFAEFSYNNSFQSSIQMSPFEALYGRKCRTPLYWSEV
GERQFFGPAIINEAEKNVTLIRDRLKEAQTRQKSYSDRRRRELSFDVGDHVYLKVSPMRG
TQRFQIHGKLAPRYIGPYQIISKRGQVAYQLELPFQLSNIHDVFHVSQLKKCLRTPIEHT
SLEDINLKPNLSYQEYPIRILEESERRTRKSSIKILRVQWSNHTADEATWEREDRLKAEF
PSFF
Download sequence
Identical sequences LOC_Os09g09400.1|PACid:21927263 39947.LOC_Os09g09400.1 LOC_Os09g09400.1|13109.m00806|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]