SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os09g36760.1|PACid:21928057 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os09g36760.1|PACid:21928057
Domain Number - Region: 508-623
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0314
Family FCH domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os09g36760.1|PACid:21928057
Sequence length 653
Sequence
MGLCQSRLERQEAVSRCKARRRYTKQLVQARRDMAAAHALYLRALRATGAALLQFASAEA
DHPHPHHHVSAAPPPPQTPPSPPPPPPPPPPPPPPLSPTPTTTSWTTNSSSISASPILPP
PPPPPMPSSWDFWDPFAPSSSRSATEDAEWDDAATTIVDAPNAPPVVTVAAAAAPPPSVV
TATTTTSTASELTVVAVPRGGGGAGKKDLAEIATELDEYFLKAADAGARVAALLEAPNCE
PPETNNSSFPGKVLNYGKNLRPMGWSWGGSGYSKGSNGFSRFGRGDEGMGNGGSSGILSH
SSTVEKLYAWEKKLFLEVKSYEGLKQEHDKKIGLLRKQEVKGVDYLKMEKNKMEIESLDS
KMLVATQSIETTTSEIMRLRESELFPQLLELVAGLMSMWRGMYECHQVQTHMVQQLEYLN
NSLSTNPTSNVHRQAALQLEIEVDRWYSAFCSLVKSQRDYVYSLTGWLRLSLFQSYHDPY
NKAHQNSDIYSLCEEWQLAIDRIPDKVASEGIKTLLTVIHAVVVQQAEEQKQKKRSESAF
KELEKKAEELRSLESKYGPYSGAEGYGDMSRKSPVSDKRAKVEALRCRADEEKSKYEKSI
GVTRAMTLNNLQTGFPNVFQAMTGFASVCMEAFESVYNFKSSDRILDSKRLLT
Download sequence
Identical sequences A0A0P0XQP5
XP_015612181.1.37577 LOC_Os09g36760.1|13109.m03629|protein LOC_Os09g36760.1|PACid:21928057 39947.LOC_Os09g36760.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]