SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g06520.1|PACid:21883763 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g06520.1|PACid:21883763
Domain Number 1 Region: 730-1099
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.45e-144
Family Reverse transcriptase 0.00013
Further Details:      
 
Domain Number 2 Region: 1272-1430
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.77e-43
Family Retroviral integrase, catalytic domain 0.01
Further Details:      
 
Domain Number 3 Region: 584-691
Classification Level Classification E-value
Superfamily Acid proteases 6e-16
Family Retroviral protease (retropepsin) 0.055
Further Details:      
 
Domain Number 4 Region: 523-561
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000244
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g06520.1|PACid:21883763
Sequence length 1624
Sequence
MVLMVVLMTIKDRFASYCCETFIVPTTSQRGQRLYLLYSVIHYSAPDCETARSPWGSLGS
PYLVYKGVIMIQERCAVMGYVVRGVLSRLLSEMPPHSPRNLIEVLGFVRELRLMAFEVGY
EVAPEYRQISHDPDEEKCRVRVTLASDSEDLPSFKFEAGGRSYCHACQEAALVAIGELRQ
RFEEELDSSAFQYHPHKPHGQDYGTYICPDGEESATLMHAVHMLSAMDAVSVERDKAAHD
RENWNQGKICKLKSKVYRLQKELAELKGETPPPTPKLRLTARKRTCPPPRLQLASKIRVM
GEAVPDHAEPVIDIISDEEEEEDPEEREPATPEEEDPSLRSDARRKAEGEPITWQEFTAA
FKKTHIPSGVVALKKREFRALNQGSRSVTEYLHDFNRLARYAPEDVRTDEERQEKFLEGL
NDELSYALMSTDFRDFQQLVDKAIRQEDKYNRMEQKKRRAAQFKAQQGSNQRPRLVTGPQ
APSYPQGGSSSVVRPQRQFYNNNTGNRGNDNRNVVARPAATPAQNQPVRKEQGSKPVVCF
NCGDPGHYADKCPKPRRVKNAPAPNNSNVPAPKARVNHVAAAEAQNAPDVVLGTFPVNSI
PATVLFDSGATHSFLSKSFASNHGMEVVSLGRPLLVNTPGNQVFSTQYCPSVTIEIEEVP
FPSSLILLESKDLDVILGMDWLSRHRGVIDCANRKVTLTSSNGETVSFFVSSPKSHGVIL
NQVALQEIPIVQDYPDVFPEDLPGMPPKRDIEFRIDLVPGTNPIHKRPYRMAANELAEVK
KQVDDLLQKGYIRPSTSPWGAPVIFVEKKDHTQRMCVDYRALIEVTIKNKYPLPRIDDLF
DQLEGATVFSKIDLRSGYHQLRIREEDIPKTAFTIRYGLFECTVMSFGLTNAPAFFMNLM
NKVFMEYLDKFVVVFIDDILIYSKTKEEHEEHLRLALEKLREHQLYAKFSKCEFWLSEVK
FLGHVISSGGVAVDPSNVELVLSWKQPKTVSEIRSFLGLAGYYRRFIENFSKIARPMTRL
LQKEVKQLRPHENNYPTHDLELAAVVHALKIWRHYLFGNRTEIYTDHKSLKYIFTQPDLN
MRQRRWLELIKDYDMEIHYHPGKANVVADALSRKSYCNMSEGRRLPWELCQEFEKLNLGI
VSKGFVAALEAKPTLFDQVREAQVNDPDIQEIKKNMRRGKAIGFVEDEQGTVWLGERICV
PENKELKDTIMKEAHETLYSIHPGSTKMYQDLKQQFWWASMRHEIAEYVALCDVCQRVKA
EHQKPAGLLQPLKIPEWKWEEIGMDFITGLPRTSAGHDSIWVVVDRLTKVAHFIPVKTTY
TGNKLAELYMARVVCLHGVPKKIVSDRGSQFTSKFWQKLQLELGTRLNFSTAYHPQIDGQ
TERVNQILEDMLRACVLDFGGSWDNNLPYAEFSYNNSYQASLQMSPNEALYDRKCRTPLL
WDQTGERQVFGTDILREAEEKVKIVQERLRIAQSRQKSYADNRCRDLAFEEGDCVYLRVT
PLRGVHRFQTKGKLAPRFVGPFKIVSRRGEVAYQLELPPSMAGIHDVFHVSQLKKCLRVP
TEETDPDRIELQEDLTYVEKPVRILEFPTFRRRAFPLRKVPKRLRKPKASHTDPKQPFEH
VEPV
Download sequence
Identical sequences LOC_Os10g06520.1|PACid:21883763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]