SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g25720.1|PACid:21885423 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g25720.1|PACid:21885423
Domain Number 1 Region: 356-785
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.45e-177
Family Reverse transcriptase 0.0000113
Further Details:      
 
Domain Number 2 Region: 945-1104
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.02e-45
Family Retroviral integrase, catalytic domain 0.011
Further Details:      
 
Domain Number 3 Region: 198-303
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000866
Family Retroviral protease (retropepsin) 0.042
Further Details:      
 
Domain Number 4 Region: 143-183
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000576
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g25720.1|PACid:21885423
Sequence length 1245
Sequence
MTVTEYLHEFNRLARYAPEDVRTDAEKQEKFLAGLDDELTNQLISGDYANFERLVDKAIR
QEDQRNKMDRKRKAAQFRAPQGSHQRPRFAPGQQGGPTTMIVRQYRPFNPSNFPQGASGS
QNHHGGQPNRGAAPRPPTAPAQSGLSAQAKKETGAKPGSCFNCGELGHFADKCPKPRRAG
PRFIQARVNHASAEEAQAAPEVVLGTFPVNSIPATVLFDSGATHLFISKKFVGMHGLRKE
ELSTPMRVHAPGNSSTSVSFSPSVLIEIQRSPFLANLILLKSKDLDVILGMDWLTQFKGV
IDCANRTVTLTNEKGETVVYKSPDSPKQGVSLNQIEAEIPVVTVEKNLRKLEDIPIVCEY
PEVFPEDLTTMPPKREIEFRIDLAPGTAPIYKRPYRMAANELAEVKKQVDEQLQKGYIRP
STSPWGAPVIFVEKKDKTKRMCVDYRALNEVTIKNKYPLPRIDDLFDQLKGAKVFSKIDL
RSGYHQLRIREEDIPKTAFTTRYGLYECTVMSFGLTNAPAFFMNLMNKVFMEFLDKFVVV
FIDDILIYSKSEEEHEQHLRLVLEKLKEHQLYAKFSKCDFWLTEVKFLGHVITAQGVAVD
PSNVESVTKWTPPKTMSQIRSFLGLAGYYRRFIENFSRIARPMTQLLKKDEKFKWTAECD
KSFEELKKKLVSAPVLILPDQMKDFQVYCDASRHGLGCVLMQEGRVVAYASRQLRPHEGN
YPTHDLELAAVVHALKIWRHYLIGNRCEVYTDHKSLKYIFTQPDLNLRQRRWLELIKDYD
MNIHYHPGKANVVADALSRKSYCTALCIEGMCEKLQQELERLNVGIVEHGFVAALEARPT
LVDQVRAAQVNDAEIAELKKNMRVGKARDFLEDEHGTIWLGERLCVPDDKELKDLILTEA
HQTQYSIHPGSTKIMRREIAEFVALCDVCQRVKVEHQRPAGLLQPLQIPEWKWEEIGMDF
ITGLPRTSSGHDSIWVVVDRLTKVAHFIPVHTTYTSKRLAELYLSRIMCLHGVPKKIVSD
RGSQFTSKFWQKLQEELGTRLNFSTAYHPQTDGQTERVNQILEDMLRACALDFGGAWDKN
LPYAEFSYNNSYQASLQMAPFEALYGRKCRTPLFWDQTGERQLFGTEVLAEAEEKVRIIR
ERLRIAQSRQKSYADNRRRELTFEAGDYVYLRVTPLRGVHRFQTKGKLAARFVGPYKILE
RRGEVAYQLELPSNMIGIHDVFHVSQLKKCLRVPEEQAFSEHIDL
Download sequence
Identical sequences Q8S5P1
LOC_Os10g25720.1|13110.m02173|protein LOC_Os10g25720.1|PACid:21885423 39947.LOC_Os10g25720.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]