SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g40590.1|PACid:21884585 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g40590.1|PACid:21884585
Domain Number 1 Region: 356-733
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.32e-114
Family Oxysterol-binding protein 0.001
Further Details:      
 
Domain Number 2 Region: 48-86,116-172
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g40590.1|PACid:21884585
Sequence length 742
Sequence
MRAREMHPLCCLVSDCALGGGGGGGGGEGGGGDCSPTKAAVGGEEEVVAVAGVLYKWTNI
GKGWRPRWFAIRGGVLAYSKIRRRVAAEPPPEAAAAAAANGVRLIGVPRGGVGDQPIGFV
PLKISSFSESKSDDKRFYIITPTKTLQLRTGSAKDRVAWIEALVSARSEYSLNGGVPCDQ
NEGSFSTEKLRNRLHAEGVGEATIKDCEQIIHSEFSQYHTQMKQRCEDYLNFIGSLPREL
EVVNSGDASAIEKPQSELFKHDCSSSGKCSEYSNTESSDDAGKQEVGQLSDEDEFHFYDT
RQSFSDTAASPDLKMRCSNSGSGAHKFGELLAIDKTNEYLLSSSKRRSELPVPIEKEKGV
SLWSMIKDNVGKDLTRVCLPVYFNEPLSSLQKCFEDLEYSNLLDRAYEYGSRGNGLMRIL
YVAAFAVSGYASTDSRPCKPFNPLLGETYEADYPEKGIRFFSEKVSHHPMVMACHCEGKG
WKFWGDSNLKSKFWGQSIQLDPSGVLTLQFDDGETFQWSKVTTTINNLIIGRVYCHHHGT
MNISGNRQYSCKLTFKEQSFLDRNPRQVQGLVTDANGTKVAFLMGKWDESMSCIIGDDAS
KVNSRNANQSTGATLLWEKNVPPANPTRYNLSSFAITLNELTPGLKEKLPPTDSRLRPDQ
RHLENGEYEKANSEKLRLETRQRMARKMQESGWKPRWFQRDTEDGTFRYVGGYWEAREQR
KWVGCNDIFGNNVSTLCTSASI
Download sequence
Identical sequences Q9AV10
LOC_Os10g40590.1|PACid:21884585 39947.LOC_Os10g40590.1 XP_015614786.1.37577 LOC_Os10g40590.1|13110.m03762|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]