SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os10g42060.1|PACid:21885771 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os10g42060.1|PACid:21885771
Domain Number 1 Region: 39-270
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 1.7e-52
Family Shiga toxin, A-chain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os10g42060.1|PACid:21885771
Sequence length 296
Sequence
MMGHLITKMLLLLVSLAPVAAGEHGVAAAEPRLVEIPFNFSVHSWNELISNRLKAELADN
PCRQEIEGIPTMAGLHGDDEPPAKWITVRLFGGGDRDDDQAKLLVAEDDAYVAGFANRTG
HWHTFRGGRCYPALPATACTELPFGGSYRDLIGGVANLRAVPVGRSSAVGAMEVLSRYDP
AATTAAADAKMALAKFMVMVTEAARLKPVRRAVVERWEQVSYLSSDEVRDVPYYGKMSLM
ILEWKRTGRWGELGPWANIDRARCPRPTGCEDEDDADADAGAGELRGLRAIHAGTS
Download sequence
Identical sequences B9G746
LOC_Os10g42060.1|PACid:21885771 39947.LOC_Os10g42060.1 XP_015613742.1.37577 LOC_Os10g42060.1|13110.m03944|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]