SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g10900.1|PACid:21946559 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os11g10900.1|PACid:21946559
Domain Number 1 Region: 807-1236
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.45e-177
Family Reverse transcriptase 0.0000124
Further Details:      
 
Domain Number 2 Region: 1408-1567
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.33e-45
Family Retroviral integrase, catalytic domain 0.011
Further Details:      
 
Domain Number 3 Region: 647-754
Classification Level Classification E-value
Superfamily Acid proteases 1.09e-16
Family Retroviral protease (retropepsin) 0.036
Further Details:      
 
Domain Number 4 Region: 593-634
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000471
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 
Weak hits

Sequence:  LOC_Os11g10900.1|PACid:21946559
Domain Number - Region: 1680-1759
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000102
Family Chromo domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g10900.1|PACid:21946559
Sequence length 1777
Sequence
MAGHPPNHRGEGMIDFVAELARMTLVVGYPNAPEYTTIPPLSGELPHRVRLEVHGYVGTC
LANMAVEASGGTADHACQEAAYLMMARLRERHDYIFHDTAYRYHPCRANGDGVSSFRPTA
GENDTTFGHMCAVVRGLDRMHSDLHKATKALNDGKLMGIVALKDEIARLKKENAQLKGLP
VPGGVRIRTTPRKTTTAPVRIQLAPRNPPPAAAPAAPPVPPAVPAAPVPAPAFTLSFAPA
SAARGPASGTGGCLFGMVYTRNGSRATGEGSNGEERADGVHPNSDSGNGPPPLPENPTLA
QVMAHQTQMMAAMMQQMQQQHQQMHQRMMQHAEQQHQQFGPPPPQSKLPEFLRVRPPTFS
STTNPMEANDWLHAIEKKLNLLQCNDQEKVAFATHQLQGPASAWWDNHMATRPPGTEVTW
AEFCRSFRKAQVPDGVVAQKKREFRALHQGNRTVTEYLHEFNRLARYAPEDVRTDAEKQE
KFMAGLDDELTNQLISGDYADFERLVDKAIRQEDQRNKMDRKRKAAQFRAHQGSHQRPRF
TPGQQGGPTTMIVRQHRPFNPSNFHQGTSGSQNHHGGQPNRGAAPRPSVAPAQSGQPAQA
KKETGAKPGSCFNCGELGHFADKCPKPRRAGPRFIQARVNHASAEEAQTAPEVVLGTFPV
NSIPATVLFDSGATHSFISKKFVRMHGLIREELSTPMRVHTPGNSSTSVQFSPSITIEIQ
RSPFLANLILLESKDLDVILGMDWLTKFKGVIDCASRTVTLTNEKGETVVYKSLVSPKKG
VSLNQIETEIPVDTVEKNLRKLEDIPIVCEYPEVFPEDLTTMPPKREIEFRIDLAPGTAP
IYKRPYRMAVNELAEVKKQVDEQLQKGYIRPSTSPWGAPVIFVEKKDKTKRMCVDYRALN
EVTIKNKYPLPRIDDLFDQLKGAKVFSKIDLRSGYHQLRIREEDIPKTAFTTRYGLYECT
VMSFGLTNAPAFFMNLMNKVFMEFLDKFVVVFIDDILIYSESEEEHEQHLRLVLEKLKEH
QLYAKFSKCDFWLTEVKFLGHVITAQGVAVDPSNVESVTKWTPPKTVSQIRSFLGLAGYY
RRFIENFSRIARPMTQLLKKDEKFKWTAECDKSFEELKKKLVSAPVLILPDQMKDFQVYC
DASRHGLGCVLMQEGRVVAYASRQLRPHEGNYPTHDLELAAMVHALKIWRHYLIGNRCEV
YTDHKSLKYIFTQPDLNLRQRRWLELIKDYDMSIHYHPGKANVVADALSRKSYCTALCIE
GMCEELRQEFEHLNMGIVEHGFVAALEARPTLVDQVRAAQVNDPEIAELKKNMRVGKARD
FHEDEHGTIWMGERLCVPDDKELKDLILTEAHQTQYSIHPGSTKMYQDLKERFWWVSMRR
EIAEFVALCDVCQRVKAEHQRPAGLLQPLQIPEWKWEEIGMDFITGLPRTSSGHDSIWVV
VDRLTKVAHFIPVHTTYTGKRLAELYLARIMCLHGVPRKIVSDRGSQFTSKFWQKLQEEL
GTRLNFSTAYHPQTDGQTERVNQILEDMLRACALDFGGAWDKSLPYAEFSYNNSYQASLQ
MAPFEALYGRKCRTPLFWDQTGERQLFGTEVLAEAEEKVRIIRERLRIAQSRQKSYADNR
RRELTFEAGDYVYLRVTPLRGVHRFQTKGKLAPRFVGPYKILERRGEVAYQLELPSNMIG
IRDVFHVSQLKKCLRVPEEQADSEHIDIQEDLTYVEKPVRILDTSERRTRNKVTRFCRVQ
WSHHSEEEATWEREDELKAAHPHLFTSSSESRGRDSV
Download sequence
Identical sequences Q2R8V3
LOC_Os11g10900.1|13111.m01155|protein LOC_Os11g10900.1|PACid:21946559 39947.LOC_Os11g10900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]