SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g14650.1|PACid:21948323 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os11g14650.1|PACid:21948323
Domain Number 1 Region: 501-808
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.94e-122
Family Reverse transcriptase 0.00018
Further Details:      
 
Domain Number 2 Region: 357-462
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000909
Family Retroviral protease (retropepsin) 0.033
Further Details:      
 
Domain Number 3 Region: 992-1065
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000885
Family Retroviral integrase, catalytic domain 0.082
Further Details:      
 
Domain Number 4 Region: 297-329
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000119
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g14650.1|PACid:21948323
Sequence length 1535
Sequence
MVLTRSNGNGPNNNNNNNNNNNRENPTLAQVLAQQAQLMSMMMQQLQNQQNQGNNHAPPK
NKLAEFLRVRPPTFSSTTNPVEAGDWLHAIEKKLDLLQCTDQEKVSFASHQLHGSTSEWW
DHFRLNRTTAEPITWLEFIAAFWKTHIPSGVVSLKKKEFSALTQGSRSVTEYLHEFNRLE
DVRTDEERQEKFLEGLNDELSYPLMTGDYHDFQKLVDKAIRQEDKYNRMEQKKRRIAHFK
AQQGNSQRPRLVMGPQAVSQGGSSSVVHPQRQFFNNNAGNNNRNQALRPVATLIQHQPAK
REQGNKPGVCFNCGELGHYSDKCPKPRRVKVVPAQNNSTAPATKARVNHVAAAEAQGAPD
VILGTFPVNSVPATVLFDSGATHSFLSMSFAGNHGMEIEDLRRPLMVSAPSNQALLSQRS
PSVRIEIQGVPFLANLILLESNDLDVILGMDWLARYKGVIDCTNRKVTLTSNDGQVVTVH
ALPSEPSRSSFNQITLEEIPIVWDYPDVFPDDLPSMPPKRDIEFRIDLVLGTTPIHKRPY
RMAANELAEVKRQVDDLLQKGYIRPSSSPWGAPVIFVEKKDHTQRMCVDYRVLNDVTIKN
KYPLPKIDDLFDQLKGATVFSKIDLRSGYHQLRIKEENIPKTAFTTRYGLFECTVMSFGL
TNAPAFFMNLMNKVFMEYLHKFVVVFIDDILIYSRTKEEHEEHLRLALKKLREHQLYAMF
SKCEFWLSEVKFLGHFISAGGVAVDPSNVESITNWKQPKIVSEIRSFLGLAGYYRRFIEN
FSKIAKPMTRLLQKDVKYKWQRRWLELIKDYDIEIHYHPGKANVVADALSRKGYCNATEG
RQLPLELCKEFERLNLGIVSRGFVAALEAKPTLIDQVREAQVNDPDIQEIKKNMRRGKAI
GFLEDEQGTVWLGERICIPDNKELKDAILREAHDTLYSIHPGSTKMYQDLKEKFGWASMK
REIAEYVAVCDVCQRVKAEHQKPAGLLQLLKIPEWKWEEIGMDFITGLPRTSSGHDSIWV
IVDRHTEVAHFIPVRTTYSGSRLAELYMARIVCLHGVPKKIVSDRVIKLVFKWLLMKRCM
VGSAALRFCGIKRENVRDLSFEEEDHVYLRVTPLRRVHRFHTKGKLAPRFVGPYKIVSRR
GEVTYQLELPQSLADVHNVFHVSQLKKCLRVPTKEANLEQIEVQEDLTYVKKPIRILETD
ERRTRNRVNRFCKIPTFPESPTLQEKTLKSSKANKAKIPGVTSWYEDVIVVAEEEEEEVH
AVEPVDDDDVHVGGNGQHNTVDDADNDLEEMLRHAETEVVAGFARGLDNFDALKKATNDL
LYNEAKGCEKDFTLLRTVLELMRLNARNGWSDSSFNDLLVLSKKFFPQPNSLPTSTNEAK
KLICPLSLGVRKIHACVNHCILFRKEYEDLDKCPTCKSSRYKTSRSQSEGLDVALDDVEE
SNPCKDSNKKKIPQLVMWYLPVKKKETNKRKRNDAKVPASPSVPFKKYSIFFKYLPYWKD
LDIRHSIDVMHLEKNVFDSTIGTILDIPTKTKDGL
Download sequence
Identical sequences Q53N07
LOC_Os11g14650.1|13111.m01508|protein LOC_Os11g14650.1|PACid:21948323 39947.LOC_Os11g14650.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]