SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g24000.1|PACid:21948504 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os11g24000.1|PACid:21948504
Domain Number 1 Region: 389-706
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.11e-117
Family Reverse transcriptase 0.00066
Further Details:      
 
Domain Number 2 Region: 799-957
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.3e-41
Family Retroviral integrase, catalytic domain 0.014
Further Details:      
 
Domain Number 3 Region: 284-345
Classification Level Classification E-value
Superfamily Acid proteases 0.000000563
Family Retroviral protease (retropepsin) 0.035
Further Details:      
 
Domain Number 4 Region: 196-233
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000105
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 
Weak hits

Sequence:  LOC_Os11g24000.1|PACid:21948504
Domain Number - Region: 1069-1152
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000495
Family Chromo domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g24000.1|PACid:21948504
Sequence length 1158
Sequence
MATQTQLLQAIANNQGNRGGSSFGEFIRTKPPTFAMADEPMEAEDWLCIIEKKLTLVREA
REEDAGEPTWEEFTAAFRENFVPAAVMRMKKNEFRRLRQGNTTVQEYLNRFTQLARYAIG
DLADEEEKIDKFIEGLNDELRRPMIGQDHESFQSLINKGVPQRLKGATSSGWKPPIVATN
RPAAPSHFNRPVAIQNRTSTPTLAAPGAKKNVDCFNYGEYGHYANSCPHPRKTPVRTGAN
AMTVRGTTTPAVGRGLFKIPQTNRTATGFGRGQASQKHNLTLVGLRKPMIVHSPGGEITV
SHACIDVPIRLRDVVFPSNLMVLIPQTLDVILGMDWLTKNRGVIDCRRREVTLTTPWGSD
MRAPMDQDPRLTERAGGIFTMLPLKGMPVVQQFPDVFPEDLPGMPPDRDIEFIIDLIPGT
APISKRPYQMPVNELEELKKQIRELQEKGFVRPSSSPWGAPVLFVKKKDGSMRMCVDYRS
LNEVTIKNKYPLPRIDDLFDQLKGAKVFSKIDLQSGYHQLKIRTGDIPKTAFSTHYGLYE
FTVISFGLTNAPAYFMNLMNKVFMDYLDKFVVVFIDDILIYSKDEEEHAEHLRLVLEKLR
KHKLYAKFSKWEFWQGLGGVLMQDGKVVAYASRQLRPHEENYPTHDLELVAVVHALKIWR
HYLIGNHCDIYTDHKSLKYIFTQSDLNLRQRRWLELIKDYDLEIHYHPGKANVVADALSR
KSHCNHLRTEGMAPELKEEMAQLNLHIVPHGQINTLDIQPLLRTQIEEAQKDNEEIREMK
ERLAAGFAKEFSTDEKDVLWIPEWKWDEIVMDFIVGLPKTATRYDSIWVIVDRLTKTARF
IPVKTNYSSAKLAELYMTRIVCLHGVPKRIISDRGTQFTSHFWEKVHEALGSYLAFSTAY
HPQTDGQTERTNQVLEDMLRACALDFSKDWERCLPYAEFSYNNSFQASLKMSPNEALFGR
RCRTPLMWSETGERAVFGPNIIKEAEEKVRLIQDRLKVAQSRQKSYADTRRRNLEFKEGD
YVYLKVSPMRGTKRFKVKGKLAPRYVGPFQIITRRGEVAYQLQLPENIANVHPVFHVSQL
KKCLRVPEEQAPLEEIHISNDLTYPEHPIRILDEAEKRTRSKVWRMYKVQWSNHTEDEAT
CESEEFLRTEYPHLFENW
Download sequence
Identical sequences Q53L81
LOC_Os11g24000.1|PACid:21948504 LOC_Os11g24000.1|13111.m02284|protein 39947.LOC_Os11g24000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]