SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g24012.1|PACid:21944614 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os11g24012.1|PACid:21944614
Domain Number 1 Region: 315-714
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.89e-153
Family Reverse transcriptase 0.0000683
Further Details:      
 
Domain Number 2 Region: 886-1046
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.28e-43
Family Retroviral integrase, catalytic domain 0.016
Further Details:      
 
Domain Number 3 Region: 171-275
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000363
Family Retroviral protease (retropepsin) 0.025
Further Details:      
 
Domain Number 4 Region: 108-144
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000984
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 
Weak hits

Sequence:  LOC_Os11g24012.1|PACid:21944614
Domain Number - Region: 1158-1236
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000242
Family Chromo domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g24012.1|PACid:21944614
Sequence length 1255
Sequence
MDPELSVRLVSGDYLDFQRLVDKSICLEAKHKELESHKRRLANFRNQQGANERIRYTNPY
PGGSSSQQQQQPRSTSRHQFVVRVPQPQQQQNQQGTRAPRPPAPAVQPGQGRRDAQGQQH
LCFNCFEPGHFADKCSKPRRQQDQTPPHPNNGGKDVTRGRVNHVTAEDVLTTPDIIVGTF
LIHSIPATILFDSKASHSFISVPFVGRNQLGVERLRNPLLITTPGGVMTAKYYSPAVPIE
IQGIPFPSDLIPLDTKYLDVILEMNWLAQFQGVVDCARRTVTLYRGPDQPVVFFAPPTSA
GSSVLHQLGLPEIPIVSEFGDVFPKELPGMPPKREIEFRIDLAPGTTPLYKRPYRMATNE
LAEVKRQLEELKEKGALNEVTIKNKYPLPRIDDLFDQLKGATVFSKIDLRSGYHQLRIRE
EDIPKTAFTTRYELYEFTVMSFGLTNAPAFFMNLMNKVIMEYLDKFVVVFIDDILVYSQS
EEDHQQHLRLVLGKLREHQLYAKLSKCEFWLSEVMFLGHVISAKGVAVNPETVIAVTDWK
QPKTVTQVRSFLGLAGYYRRFIENFSKIARPMTQLLKKEEKFVWSPQCEKAFQTLKEKLV
SSPVLILPDTRKDFLVYCDASRQGLGCVLMQEGHVVAYASRQLWPHEGNYPTHDLELAAV
VHALKIWRHYLIGNRCEIYTDRKSLKYIFTQSDLNLRQRRWLELIKDYDVGIHYHPGKAN
VVADALSRKSRCNTLGVRGIPPELNQQLEALNLSIVSHGFLATLEAKPILLDQIREAQKN
DPDMHGILKNMKQGKAAGFTEDEHGTLWNGNRVCSPNDKELKQLILQEAHESPYSIHPGS
MKMYLDLKEKYWWVSMKREIAEFVALCDVCQRVKAEHQRPAGLLQPLQVPEWKWDEIGMD
FITGLPKTQGGYDSIWVVVDRLTKVARFIPVKTTYGGKKLAELYFARIVSLHGIPKKIVS
DRGSQFTSHFWKKLQEELGTRLNFSTVYHPQTDGQTERLNQILEDMLRACVLDFGKTWDK
SLPYAEFSYNNSYQASIQMAPYEALYGRKCRTPLLWDQVGESQVFGTDILREAEAKVRTI
RDNLKVAQSRQKSYADTRRRNLEFAVDDFVYLRVTPLRGVHRFQTKGKLAPRFVSPFRIL
ARRGEVAYQLELPASLGNMHDVFHVSQLKKCLRVPSEQADSEQIEVREDLTYVEKPMKIL
DSMERRTSNRVIRFCKVQWSNHAEKGATWEREDELKAAHPDLFTCSSESRGRDSI
Download sequence
Identical sequences Q53L84
LOC_Os11g24012.1|13111.m02286|protein 39947.LOC_Os11g24012.1 LOC_Os11g24012.1|PACid:21944614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]