SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g24270.1|PACid:21948541 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os11g24270.1|PACid:21948541
Domain Number 1 Region: 548-977
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.22e-172
Family Reverse transcriptase 0.0000115
Further Details:      
 
Domain Number 2 Region: 1149-1310
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.39e-42
Family Retroviral integrase, catalytic domain 0.016
Further Details:      
 
Domain Number 3 Region: 398-505
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000866
Family Retroviral protease (retropepsin) 0.03
Further Details:      
 
Domain Number 4 Region: 319-352
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000314
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Weak hits

Sequence:  LOC_Os11g24270.1|PACid:21948541
Domain Number - Region: 1420-1499
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00467
Family Chromo domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g24270.1|PACid:21948541
Sequence length 1506
Sequence
MTHTHSMAALTDDANGEGASQPRTGPYSSGRAGGSRRAATAEQHDDEPSLAQLLANQNRL
FERMVANSENMGAAMAQQANQAPSKLADVQRTHPPHFSSAADPLAADDWLRDIEIKLNLC
RCDPVEKATFAAYYLQGAAAAWWETYKTLIPPDEPITWTVFREGFRSAHIPAGLMEIKKK
EFLNLKQGNMPFMEFMERFNYLGRYAASDLNTETKKVELCRDRLAPELKHALAAHEITSM
KTLVDKALRVESSEKEVVEDRKRKWAAKKFAGSSSSTRPRLAPSPAVRPMAPQPPRQMYV
PPRPQTQLVRQVPRAVQAAGDASRNANVTCYNCGKKGHYSPSCPYPKTGKSGPYSQGAPQ
QPRGPPQVQPGQRGAPAVPKPAPTFGRGRLNHVTAEEATDAPGVVLGTFLVHSIPLTVLF
DSGATHSFMSTLKAKQLDLKTEFLSDAMRIQSPGSTMVTKLLCKGVELIIDGVKFKANLI
LLDTLGLNVILGMDWLTKHEGTIDCAHRTVTLRSTDGQFVRFTFEQTSTSNQPSIQSLSI
PELKSVPIVNEYSDVFPDELPGMPPDRDIEFVIDLIPGTAPIAKRPYRMTSENLMELKKQ
LNEQLAKGFIRPSSSPWGCPVLFVPKKDGTMRMCVDYRPLNEVTIKNKYPLPRIDDLFDQ
LTGTRVFSKIDLRLGYFQLKIRPEDIPKTAFTTRYGLFEYTVVSFGLTIAPASFMNMMNK
IFMEYLDKFVVVFIDDILIYSKSEEEHAQHLRMVLDKLREHQLYAKFSKCEFWLKEVEFL
GHVLSEGGIAVNPRNVQNVLNWKQPQNVPEIRSFLGLAGYYRRFIENFSKIARPLTQLLK
KENKFIWSEACETSFHELKRRLTTAPVLVMPDVLKPFNVYCDASHHGLGCVLMQEGKVVA
YASRQLRPHEINYPTHDLELAAVVHALKIWRHYLVSNRCEIFTDHKSLKYFFTQPDLNLR
QRRWLELIKDYDLGIHYHPGKANVVADALSRKLHHLAVIETINQPSLSSEFQKLNLGLVE
DGYVAALALQPTLYSQIKAAQSIDEEVAEIMKEINSKPQSIYTLNSDGMVMLGKRIFVPN
NQHLRETILDEAHQTPLSIHPGCTKMYQDIRTQYWWPSLRRDIAAYVAICDVCQRVKAEH
QRPAGLLQPLQVPEWKFDEVGMDFITGLPKTPNGHDSIWVIMDRLTKVAHFIPVHVTYGG
AKLAELYLTHIVRLHGVPKVIVSDRGTQFTSRFWKNLHELLGTKLFLSTAFHPQTGGQVE
RTNQILEDMLRACVLEHNTNWEKCLSFAEFSYNNSFQSSIQMSPFEALYGRNCRTPLYWS
EVGERQFFGPAIINEAEKNVTLIRDRLKEAQTRQKSYSDRRRRELSFDVGDHVYLKVSPM
RGTQRFQIHGKLAPRYIGPYQIISKRGQVAYQLELPFQLSNIHDVFHVSQLKKCLRTPIE
HTSLEDINLKPNLSYQEYPIRILEESERRTRKSSIKMLRVQWSNHTVDEATWEREDRLKA
EFPSFF
Download sequence
Identical sequences Q53PJ3
LOC_Os11g24270.1|PACid:21948541 LOC_Os11g24270.1|13111.m02313|protein 39947.LOC_Os11g24270.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]