SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g39790.1|PACid:21946727 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os11g39790.1|PACid:21946727
Domain Number 1 Region: 890-1253
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.89e-142
Family Reverse transcriptase 0.0000403
Further Details:      
 
Domain Number 2 Region: 1425-1582
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.97e-43
Family Retroviral integrase, catalytic domain 0.012
Further Details:      
 
Domain Number 3 Region: 741-847
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000259
Family Retroviral protease (retropepsin) 0.037
Further Details:      
 
Domain Number 4 Region: 655-691
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000349
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Weak hits

Sequence:  LOC_Os11g39790.1|PACid:21946727
Domain Number - Region: 1697-1775
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0066
Family Chromo domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g39790.1|PACid:21946727
Sequence length 1783
Sequence
MEVNASFSSHGFGEGHHVAQLRDLARFLGFSCPEYTGYSVDRVPPHCELSVYLYPRGGIH
GAGLRPHHFTVARPTLQIAYQDLSWNALRRLAHDYSHRLGGSAFRQLPRLPSGHSDARYP
CPYSESQPVLTRMVELSEAQATQHDLLLEAYRSLARRYATLEARLAEEGVTSVDTISWDS
GRLCHASHLSSHSSRGSARTPSGPRSPSSRAPYSPVYSPYPHPVSPSYTPGHTPVASSRR
GPRFIRTARKRVVGSSTVFRFRHPAPPPPAARAAAGPRQMASRPRRAARAPARFGFEDGR
VEAEANHESANEQSHRSNRSHRTVSRNAEVEQPRRSSRSHRTVSRDAEMEQSHLSHCTVS
HNSGEERLPSPPHVENNMQHIMAVQTQILQGLTTAIASFQHNVHGHPHVGNNRSKLTDFL
RSRPPEFSQTVEPVEADDWLKDVDRKLNLVQCTPVEKTLYASHQLRGPAADWWENYCNAH
PEPNNIAWDEFATAFRAAHVPESTIDMKKEEFNRLKQGNNSVNEYLSQFNKLARYAPEEV
DTDKKKIRKFLKGIAVGMRLQLLAHDFPTFQHMINKALLLEDARKEATEEYKKRKSNHQG
NSSRGAPRPRYGQPMQYHQSITQTNRQPGYAPRPQINRPAPPPQQRAPSGNTAPNSVTSF
KSPQGPSAVQCFRCNQMGHYARQCPQNPANTNSGHANGSTARTPTPAAAQSRPSSQASGQ
GSRASNHFGRGRVNHIQAETAQDAPDVVMGMFSVNSVPAIVLFDSGASHSFISQAFVKRN
GWKTQNLRVPMIVHSPGRNIRAIQICPEVNLRIEEVDFLAKPIVLDSQSLDIILGMDWLA
KHKGQIDCAEKSITLQGPGGKQVRFTPNTPTASRSILTCLQVTSLESVPIVSEYPDVFPE
ELTTNELAEVKRQIEELESKGYVRPSSSPWGAPVLLVKKKDGSERMVIDYRALNEVTIKN
KYPLPRIDDLFDQLKGARVFSKIDLRSGYHQLKIRSEDIPKTAFSTRYGLYEFTVMSFGL
TNAPAFFMNLMNKIFMEYLDQFVVKCEFWLDRVAFLGHVISSNGVEVDPSKVEAVLAWNP
PKNVSEIRSFLGLAGYYRRFIEGFSKLARPMTELLKKEKKFQWSAACEDSFQEMKKRLTT
APVLTLPDIRKDFEIFCDASRQGLGCVLMQERKVVAYASRQLRPHEVNYPTHDLELAAMV
HALKIWRHYLIGNRCEVYTDHKSLKYIFTQTELNMRQRRWLELIKDYDLGIHYHPGKANV
VADALSRKAYCNVAQTRPNQDHLCRELEKLRLTVVQSGVPASLTVQPTLESQIREAQKDD
EGIKELIKRIREKKDTNFSIDEQGTVWCGPRICVPAKKELRDLILKEAHESAYSIHPGST
KMYQDIKAYFWWAGMKRDVAEYVALCDICQRVKAEHQRPAGLLQPLPIPEWKWEEIGMDF
ITGLPRTPCGYDSIWVIVDRLTKSAHFVPVKTTYDGKKLAELYMTHVVCRFGCPKKIVSD
RGTQFTSRFWKQLHETLGTDLNFSTAYHPQTDGQTERVNQILEDMLRACALDFEGTWDRC
LPYAEFSYNNSYQASIQMSPNEAMFGRKCRTPLCWNEVGEALVFGPDILKSAEEQVKLIR
ERLKTAQNRQKNYADNRRRDLEFKKGDHVYLRVSPLRGMRRFGMSGKLAPRYIGPYLIAA
RRGEVAYQLELPEGLADVHNVFHVSQLKKCLRVPEEQVPLGSIELEKNLTYKERPIKVLE
EAERQTRRKTIKFYKVQWSNHSEDEATREREDLLRAEFPELLP
Download sequence
Identical sequences LOC_Os11g39790.1|PACid:21946727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]