SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os12g03100.1|PACid:21935202 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os12g03100.1|PACid:21935202
Domain Number - Region: 397-443
Classification Level Classification E-value
Superfamily PH domain-like 0.0102
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os12g03100.1|PACid:21935202
Sequence length 475
Sequence
MPPRARTLLMPLAAATLLVASTIFLFAATGARWRPADTGLPVPAADFSAAVLESAVTDTT
AAAKELSFVDENGRPDDPASSSAAAARCDPTHAAVRVFMYDLPPEFHFGILGWSPPTDGA
ADAAMWPDVGSGAAAPRYPGGLNQQHSVEYWLTLDLLSSSSPPCGAAVRVADSRDADVVF
VPFFASLSYNRHSRVVPPEKVSRDKELQEKLVRYLMAQPEWKRSGGADHVIVAHHPNSLL
HARSVLFPVVFVLSDFGRYHPRVASLEKDVIAPYKHMAKTFVNDSAGFDDRPTLLYFRGA
IFRKEGGNIRQELYYMLKDEKDVYFAFGSVQDHGASKASKGMHASKFCLNIAGDTPSSNR
LFDAIVSHCVPVIISDDIELPYEDALDYSKFSIFVRSSDAVKKGYLMRLIRGVSKHQWTR
MWNRLKEVDKHFEYQYPSQKDDAVQMIWQALARKVPAIRLKSHRSRRFSRYDRGK
Download sequence
Identical sequences B8BLT2 Q2QYC6
OsIBCD033920 LOC_Os12g03100.1|PACid:21935202 LOC_Os12g03100.1|13112.m00265|protein 39946.BGIOSIBCE035588 39947.LOC_Os12g03100.1 XP_015620647.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]