SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os12g04810.1|PACid:21938617 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os12g04810.1|PACid:21938617
Domain Number 1 Region: 793-1207
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.89e-158
Family Reverse transcriptase 0.0000271
Further Details:      
 
Domain Number 2 Region: 1356-1469
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.31e-23
Family Retroviral integrase, catalytic domain 0.021
Further Details:      
 
Domain Number 3 Region: 634-740
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000109
Family Retroviral protease (retropepsin) 0.03
Further Details:      
 
Domain Number 4 Region: 579-620
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000663
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os12g04810.1|PACid:21938617
Sequence length 1648
Sequence
MAGHPPNHCGEGMIDFVAELARMTLVVGYPNAPEYTTVPPLSGELPHRVRLEVHGYVGTC
LANMVVEASGGTADHACQEAAYLMMARLRERHNYIFHDTAYRFHPRRASGDDVSTFRPTA
GENDTTFGHMCAVMRGLDRMHSDLHKATKALNDGKLMRIVALKDEIARLKRENAQLKGLP
APGGVRIRTTPRKTTTKPVRIQLAPRNPPPPAAPAVPAAPAPAPVHVLAPASALSFAPAS
AARGPASGNGGCLFGMVYTRNGSRATGEGSNGEERTEGVHPNSNSGNGPPPLPENPTLAQ
VMAHQTQMIAAMMQQMQQQHQQMHQRMLQHAEQQHQQFGPPPPQSKLPEFLRVRPPTFSS
TTNPMEANDWLHAIEKKLNLLQCNDQEKVAFATHQLQGPASAWWDNHMATRPPGTEVTWE
EFCRSFRKAQVPDGVVAQKKREFRALHQGNRTVTEYLHEFNGLARYAPEDVRTDAEKQEK
FMAGLDDELTNQLISGDYADFERLMDRKRKAALFRAPQGSHQRPRFTPGQQGGPTTMIVR
QYRPFNPSNFPQGASGSQNHHGGQPSRGAAPRPPVAPAQSGPPAQAKKETGAKPGSCFNC
GELGHFADKCPKPRRAGPRFIQARVNHASAEEAQATPEVVLGTFPVNSIPATILFDSGAT
HSFISKKFVGMHGLRKEELSTPMRVHTPGNSSTSVSFSPSVLIEIQRSPFLANLILLESK
DLDVILGMDWLTKFKGVIDCANRTVTLTNEKGETVVYKSPDSPKRGVSLNQIETKIPEDT
VEKNLRKLEDIPIVCEYPEVFPEDLTTMPPKREIEFRIDLAPGTAPIYKRPYRMAANELA
EVKKQVDEQLQKGYIRPSTSPWGAPIIFVEKKDKTKRMCVDYRALNEVTIKNKYPLPRID
DLFEFDQLKGAKVFSKIDLRSGYHQLRIREEDIPKTAFTTRYGLYECTVMSFGLTNAPAF
FMNLMNKVFMEFLDKFVVVFIDDILIYSKSEEEHEQHLRLVLKKLKEHQLTPCSATQGVV
VDLSNVESVTKWTPPKTVSQIRSFLGLAGYYRRFIENFSRIARPMTQLLKKDEKFKWTAE
CDKSFEELKKKLVSAPVLILPDQMKDFQVYCDASRHGLGCVLMQEGRVVAYASRQLRPHE
GNYPTHDLELAAVVHVLKIWRHYLIGNRCEVYTDHKSLKYIFTQPDLNLRQRRWLELIKD
YDMSIHYHPGKANVVADALSRKSYCTALCIEGIRSGGTAYARGSSQSRVNDSEIAELKKN
MRVGKARDFHEDEHGTIWLGERLCVPDDKELKDLILTEAHQTQYSIHPGSTKMYQDLKEK
FWWVSMRREIAEFVALCDVCQRVKAEHQRPAGLLQPLQIPEWKWEEIGMDFITGLPRTSS
GHDSIWVVVDRLTKVAHFIPVHTTYTGKSTAYHPQTDGQTERVNQILEDMLRACALDFGG
AWDKSLPYAEFSYNNSYQASLQMAPFEALYGRKCRTPLFWDQTGERQLFGTEVLAEAEEK
VRIIRERLRIAQSRQKSYADNRRRELTFEAGDYVYLRVTPLRGVHRFQNKGKLAPRFVGP
YKILERRGEVAYQLELPSNMIGIHDVFHVSQLKKCLRVPEEQADSEHIDIQEGPNLLKEE
PETRSPGFAEFSGVIIQKRKQPGKGRMS
Download sequence
Identical sequences LOC_Os12g04810.1|PACid:21938617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]