SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os12g04830.1|PACid:21934381 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os12g04830.1|PACid:21934381
Domain Number 1 Region: 603-1032
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.78e-172
Family Reverse transcriptase 0.0000148
Further Details:      
 
Domain Number 2 Region: 1206-1366
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.64e-42
Family Retroviral integrase, catalytic domain 0.011
Further Details:      
 
Domain Number 3 Region: 445-550
Classification Level Classification E-value
Superfamily Acid proteases 7.13e-16
Family Retroviral protease (retropepsin) 0.038
Further Details:      
 
Domain Number 4 Region: 396-431
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000858
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 
Weak hits

Sequence:  LOC_Os12g04830.1|PACid:21934381
Domain Number - Region: 1442-1521
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0033
Family Chromo domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os12g04830.1|PACid:21934381
Sequence length 1539
Sequence
MSAHGNVSWGCVLWVQLYTSDQSKTIRIAVPAVMGGRPDSQWVVLSLALFSPTPELKFFS
AGAVSERFAACGLAGGRYHVLVMVKTRNDPRDSNGASGSEEQINGAHTSGASSNIPSPPP
ENPMVIQMMTMMMQQMQQHYHEMLQQAQQNQQSGPPPLHLSKLLDFLYIKPLTFSSTTNL
MEANDWLHAIEKKLNLLQCNDQEKMQRRLLGQSFVKASGRHRFPRGSWHKRREFRALQQG
TRTVTEYLHEFNRLVRYAPEDVRTDAKRQEKFLFGLDDELTNQLISGVYEDFKKLVDKAI
HQEEQRNKMDRKRKAAQFRTPQGNSQKPRFMTGQLGEPSTLIVRQHRPYHSGNFNNDYNG
GSHNSSEQHHHNSTPPPLMAPAESELPAMSAQSEQLKKESAGKPGPCFNYGKHGHFASKC
PKLKRAGPKFVQARINHASAEEAQAAPEVVLGTFLVNSYPATVLFDSGATHSFISKKFAG
THGLSVVELKIPMRVHTPGNDMNTAHYCPSMTIEIKRSPFLSNLILLESKDLDVILGMDW
LTRHKGVIDCASRTITLTNDKGEKITFRSPVSQKSVASLNQAAIKEQTEIVEKSPKELED
IPIVQEYPEVFPEDLTTMPPKREIEFWIDLAPGTAPIYKRPYRMAANELAEVKEQVDEQL
RKGYIRLSTSPWGAPIIFVEKKDKTKRMCVNYRALNEVIIKNKYPLPRIDDLFDQLKGAK
VFSKIDLRSGYHQLRIREEDIPKTAFTTRYGLFECTVMSFGLTNAPAFFMNLMNKVFMEF
LDKFVVVFIDDILIYSKSEEEHEQHLRLVLEKLKEHQLYAKFSKCNFWLSEVKFLGHVIT
AQGVAVDPSNVESVTKWTPPKTIFQIRSFLGLAGYYRRFIENFSKIARPMTQLLKKDENF
KWSVECNQSFEELKKKLVSAPVLILPDQMKDFQVYCDASRQGLGCVLMQEGRVVAYASRQ
LRPHETNYPTHDLELVAVVHALKMWRHYLIGNCCEVYTDHKSLKYIFTQPDLNLRQRRWL
ELIIDYDMSIHYHPGKANVVADALSRKSYCNALGTEGMCKELQQELEHLNLGIVEHGFVA
ALEARPTLMDQVRAAQINDPEIAELKKNMRVRKARDFLEDEHGTIWLGERLCVCVPDDKE
LKDLILTEAHQTQYSIHPGSTNMYQDLKEKFWWASMRREIAEFVALCDVCQRVKAEHQRP
AGLLQPLQIPEWKWEEIGMDFFTGLPRTSSGHDSIWVAVDRLTKVAHFIRVHTTYTDKRL
AELYLSRIMCLHGVPKKIVSDRGSQFTSKFWQRLQEELGTRLNFSTAYHPQTDGQTKRVN
QILEDMLRACALDFGGAWDKSLPYAEFSYNNSYQASLQMAPFEALERLRIAQSRQKSYTD
NRRRELTFEAGDYVYLRVTPLRGVHRFQTKGKLAPRFVGPYKILERRGEVAYQLELPSNM
AGIHDVFDVSQLKKCLRVPEEQANSEHIDIQEDLTYVEKPVRILETSERRTRNKVTRFCR
VQWSHHSEEEAIWEREDELKAAHPHLFASSSESRGRDSI
Download sequence
Identical sequences Q2QXU8
LOC_Os12g04830.1|PACid:21934381 LOC_Os12g04830.1|13112.m00469|protein 39947.LOC_Os12g04830.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]