SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os12g33910.1|PACid:21937067 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os12g33910.1|PACid:21937067
Domain Number 1 Region: 503-872
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.23e-142
Family Reverse transcriptase 0.00015
Further Details:      
 
Domain Number 2 Region: 1045-1204
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.21e-44
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 
Domain Number 3 Region: 357-464
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000108
Family Retroviral protease (retropepsin) 0.034
Further Details:      
 
Domain Number 4 Region: 297-331
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000994
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os12g33910.1|PACid:21937067
Sequence length 2360
Sequence
MVNTRSNGNGPNNPNNNNNGENPTLAQVLAQQTQLMNMMMQQFQNQQNQGNNHAPPQNKL
AEFLRVRPPVFSSTTNPVEASDWLHAIEKKLDLLQCTDQEKVSFASHQLHGPASEWWDHF
RLNRTTAEPITWLEFTAAFRKTHIPSGVVSLKKKEFRSLSQGSRSVTEYLHEFNRLARYA
PEDVRNDEERQEKFLGGLNDELSYPLMVGDYPDFQKLVDKAIRQEDKYNRMEQKKRRIAQ
FKTQQGNNQKPRLTLGPQPMPQGGSSSVVRPQRQFFNNNAGNNIRNQAPRPVAAPAQQQP
AKREQGNKPVVCFNCGDPGHYADKCPKPRRVKVVSAQSNSAVPASKARVNHVAAAEAQDA
PDVILGTFLVNSVPATVLFDSGATHSFLSMSFAGNHGMEVEDLRRPLMVSTPSNQALSLQ
RSPSVRIEIQGVPFLANLILLESKDLDVILGMDWLARHKGVIDCANRKVTLNSYDGRVVT
VHALSSESLRSRLNQITLEEIPIVREYPDVFPDDLPGMPPKRDIEFRIDLVPGTTPIHKR
PYRMAANELAEVKRQVDDLLQKGYIRPSSSPWGAPVIFVEKKDHTQRMCVDYRALNDVTI
KNKYPLPRIDDLFDQLKGATVFSKIDLRSGYHQLRIKEEDIPKTAFTTRYGLFECTVMSF
GLTNAPAFFMNLMNKVFMEYLDKFVVVFIDDILIYSRTKEEHEELLRLALEKLREHQLFI
ENFSKIAKPMTRLLQKDVKYKWSEECEQSFQELKSRLISAPILILPDPKKGFQVYCDASK
LGLGCVLMQDGKVVAYASRQLRPHEKNYPTHDIELAAVVHALKIWRHYLFGTHTEVYTDH
KSLKYIFTQPDLNMRQRRWLELIKDYDMGIHYHPGKANVVADALSRKGHCNATEGRQLPL
ELCKEFERLNLGIVGRGFVAALEAKPTLIDQVREAQINDPDIQEIKKNMRRGKAIGFLED
EQGTVWLGERICVPDNKDLKDAILKEAHDTLYSIHPGSTKMYQDLKERFWWASMKREIAE
YVAVCDVCQRVKAEHQKPAGLLQPLKIPEWKWEEIGMDFITGLPRTSSGHDSIWVIVDRL
TKVAHFIPVKTTYSGSRLAELYMARIVCLHGVPKKIVSDRGSQFTSNFWKKLQEEMGSKL
NFSTAYHPQTDGQTERVNQILEDMLRACALDFSGSWDKNLPYAEFSYNNSYQASLQMAPY
EALYGRKCRTPLLWDQTGERQVFGTDILREAEEKVKIIQERLRVAQSRHKSYADNRRRDL
SFEEGDYVYLRVTPFRGVHRFHTKEKLAPRFVGPYKIVSRRGEVAYQLELPQSLAGIHNV
FHVSQLKKCLRVPTEEANIEQIEVQEDLTYVEKPIRILETTPGLEWYIPSLEIELCSRGG
CSEWLGLYNRGSHTCKRLEFWIEIPGVTGKISLLDSVSDQSGENRISAPFGLPNAAESYF
KTISIELASNHSGEIASSPTSPDQDDGAYPPILMKLPDDLAAVSITTASPSRRPRRKSAS
TPTSPSFREVGVILQPLGTVSTDQLDGYYSSPTVDSRPTDIVEYDEFSSRYNDPDLDDFD
GSLDDNYTPLYFGVFMADNETEEQCQARETEARRETERRRLEEEHQAQEQERLRREQQER
ERTAKEAEDRRQRALEAGRRARDLIGQQDVEGTPVFRTPQQNAVAAITLLDTLLKENELN
QSDHVVNILNQTKTMIAASVPVNSESVHTPTGSRVPHSRSHDYRHLSLSITGAGSNRRSR
GHDERSVHSPPDHHRERRVERPRSPPRRRPVDLRDTIIQRRAARGHHHAPDRHDDDLDGV
AAFTDDLRRVDWPAGFKPTGIEKYDGTTNPESWLTVYGLAIRAAGGDSKAMANYLPVALA
DSARSWLHGLPRGTIGSWAELRDHFIANFQGTFERPGTQYDLYNVIQKSGESLRDYIRRF
SEQRNKISDITDDVIIAAFTKGIRHEELVGKFGRKPPKTVKLMFEKANEYAKAEDAVTAS
KQSGPSWKPNKGTPAKGGGGSNNHKDRKRKPEELVATATHSSRQRSRVNTFDKIMNSQCP
HHPNSNHVAKDCFVYKQFAEQYTKTTRKNSDEEQSTSRKKDDGDTPAGFQDHRKELNHIF
SGPLAYESKRKQKLTEREINAVQPDTPQYLRWSEIAIKFDRSDHPDRVVHPGRYPLVLDP
VVRNVKLRRTLIDGGSALNILFAKTLDDMQIPRSELKPSNAPFHGVIPGLSATPLGQITL
PVTFGTRENFRTENISFEVADFETTYHAILGRPALAKFMAVPHYTYMMTKMPGPRGVLSL
RSDIKQAVTCDKESCDMAQTREMASAREDIRLAAATASEGEVPATKISKSGESEAKTKKI
PLDPSDSTKTAVIGAELDCK
Download sequence
Identical sequences Q2QPN0
LOC_Os12g33910.1|13112.m03457|protein LOC_Os12g33910.1|PACid:21937067 39947.LOC_Os12g33910.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]