SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os12g40030.1|PACid:21936179 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os12g40030.1|PACid:21936179
Domain Number 1 Region: 320-671
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.67e-127
Family Reverse transcriptase 0.00011
Further Details:      
 
Domain Number 2 Region: 804-942
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.77e-38
Family Retroviral integrase, catalytic domain 0.011
Further Details:      
 
Domain Number 3 Region: 160-267
Classification Level Classification E-value
Superfamily Acid proteases 2.14e-18
Family Retroviral protease (retropepsin) 0.022
Further Details:      
 
Domain Number 4 Region: 112-149
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000129
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os12g40030.1|PACid:21936179
Sequence length 1082
Sequence
MVVLTGVRGEAGPDGGFGRADGGRDGPRDGERGGVNGTRTVIEYLHEFNRLARYAPEDVR
TDAERQEKFLSGLDDELTNQLISRDYEDFQKLVDKAIRQEEQALPALPAQPKQPKRLGEK
PGLCFNCNKPGHTVGKCPKPRRAGPKFVQAHVNHASAEEAQSAPEVILGTFPVNSTPAVI
LFDSGATHSFISKRFAGAHGLSLVKLKIPMRVHTPGGGMTTTHYCPSVTIEIQGLIFPAN
LILLESKDLDVILGMDWLTRHRGVIDCTSRTIKLTNAKGEVVTFQSPVLQKLGISLNQAA
GEEQEVVVEKTTKKLEDIPIVREYPEVFPDDLTTMPPKRDIEFRIDLAPGTAPIHKRSYR
MGANELAKVKKQVDEQLQKGYIRPSTSLWGAPVIFVEKKDKTKRMCVDYRALNEVFMEFL
DKFVVVFIDDILIYSKSEEEHEQHLRLVLEKLKEHQLYAKFSKCDFWLKEVQFLGHIVNA
QGVAVDPANVESVTKWTPPRTVTQVRSFLGLAGYYRRFIENFSKIAKPMTQLLKKEEKFI
WSAECNRSFAELKRRLVSAPVLILPDQTKDFQVHCDASRQGLGCVLMQDGKVVSYASRQL
RPHEGHYPTHDLELAAVVHALKIWRHYLIGNRCEVYTDHKSLKYIFTQPDLNLRQRRWLE
LIKDYDMGIHYHPGKANVVADALSRKSYCNVTWVEQLCCEVQRDLEHLNLELKKNMRVGK
ARGFVDDEQGTIWMGGRLCVPENKELKDLILTEAHQTKYSIHSGSTKMYQDLKEKFWWVS
MRREIAEFVALCDVCQREKAEHQRPTGHDSIWVVVDRLTKVAHFIPVHTTYSWKKLAELY
LARIMCLHGVPKKIVSDRGSQFTSKFWQKLQEELGTRLNFSTAYHPQTDGQTERVNQILE
DMLRACALDFGGAWDKSLPYAEFSYNNSYQASLQMAPFEALYGRKCRTPLFWDQTGERQL
FGTEVLNEAEEKVRAVSERLRIAQSRHKSYVDNRRRELVFQAGDYVYLRVTPLRGVHRFQ
TKGKLAPRFVGPYRILERRGEVAYQLELPSNMLGIHNVFHVSQLKKCLRVPEEQASPDQI
EI
Download sequence
Identical sequences Q2QMU1
LOC_Os12g40030.1|13112.m04161|protein 39947.LOC_Os12g40030.1 LOC_Os12g40030.1|PACid:21936179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]