SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_01572 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_01572
Domain Number 1 Region: 4-128
Classification Level Classification E-value
Superfamily TPR-like 1.75e-46
Family Tetratricopeptide repeat (TPR) 0.0000128
Further Details:      
 
Domain Number 2 Region: 139-251
Classification Level Classification E-value
Superfamily TPR-like 1.73e-41
Family Tetratricopeptide repeat (TPR) 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GS_01572
Sequence length 320
Comment GS_01572 GS_01572
Sequence
MASEALKEKELGNTAYKRKDFEAAISHYDKAIELDPTNITFYSNKAAVLFEQQKYEDCIE
LCKKAVDVGREQRAEYTLIAKALTRIGNAYLKLDQLKDAITWFDKSLSEHRDPELVKKKK
QLEKDLAERERLAYINPEIADKEKTLGNELFKRGNYPSAMKHYNEAIKRDPENAILYSNR
AACYTKLMEFQRALEDCEMCIKKDPTFIKGYIRKGAALIAMKEYGKAQTAFEMALALDGN
NAEAKEGLMNAIRNNDESPEKARERALHDPEVQEILRDPGMRLLLEQMSNDPGAVREHLQ
NPDILKKLMKLREAGIIQMR
Download sequence
Identical sequences A0A0M3I654 F1L533
GS_01572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]