SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_01805 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GS_01805
Domain Number - Region: 197-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0068
Family FCH domain 0.081
Further Details:      
 
Domain Number - Region: 64-129
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0863
Family GntR ligand-binding domain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GS_01805
Sequence length 314
Comment GS_01805 GS_01805
Sequence
MTLQWLAVAFILYAEIAIVLLLLLPWIRPSRWNKIFKSRLVRTLEKHANVYSVAAIAVLL
LLFVDAIREVRKYAGEIVADSPIRATADAENALHMRLFRAQRNLYISGFALLLFLVIKRI
MALLSRGAQLEAAAEAAMCQAESASKAAKSLLGGDNERETELERQLEEIGGVDEENPLHQ
KTFKGRPLRRMLCDVTFTIGHELKSAQEERDAIKEKANNLRKEYERLCNELADAQLDPFC
ENMMHENRFSDKLPQELCYCLKYNTHDLVLTLMVSCARNQLKMRSFRKHQEIRKATEYSY
FISRSSLILSAVAL
Download sequence
Identical sequences GS_01805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]