SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_01856 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_01856
Domain Number 1 Region: 210-509
Classification Level Classification E-value
Superfamily TPR-like 1.02e-87
Family Tetratricopeptide repeat (TPR) 0.000000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GS_01856
Sequence length 519
Comment GS_01856 GS_01856
Sequence
MKSLVDGDCSHANALVELSRTAAQSNARLPPTLRSSILQSSSSMGDTFANEYLTDLSRST
SAPSTFSMQQLAEQLPEQETLTARNWTNQYIRELDNAHSRTQNLSGQWTDQYIPSTSTRL
DSWADKAWEQIVQHPFDGESAATQMWSSDYLANFDQQVEEPTRKWVDEYLTGREQPLMES
GDDLFRYMEKEWEALKNGLSTVNVEMPSLSEYEMTTDNPYLNEENPLERGKNSLLAGDLP
NAVLYFEAAVQNNPHDSKAWYMLGMSQAENEKDLQAIAAFKESLDIDPKNLDALLALSVS
YANESMENEALSHLERWLSVHPLYGGFELAPRSNNITSPFLDQGNFKRVEDRFLAAARRQ
PEGGDASLQNALGVLYNLNRNYERAVDSIKAALSITPNDARLWNRLGATLANGDRTTEAI
VAYRQALALFPAYVRARYNLGISCVQLSCYNEAIEHFISALELQQSSGLGSSSGSGSSSS
IWQTLRSAIIRSGLPQYNELLAAVEARDLIRLKGMLALR
Download sequence
Identical sequences GS_01856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]