SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_04568 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_04568
Domain Number 1 Region: 5-93
Classification Level Classification E-value
Superfamily TPR-like 0.000000299
Family Transcription factor MalT domain III 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GS_04568
Sequence length 277
Comment GS_04568 GS_04568
Sequence
MYAFGLEECKEYDKAENEALKGLELRREDAWATHARAHCMEMNGRINEGIAFMESTVQNW
NPCFMLACHNYWHTALFYLERQDYDTVLSYYDSEIGIRSKSGAMLDLVDAASILFRLQME
GVDVGDRWNALLPIAESHIDDHILAFNDAHFRLITEGCGIDTIREQHRKSIRGFISTGSG
DNCRITRQIGEALCEAISSYCANDFDAVITRLAPIRKKIYEIGGSNAQGFFYTLFSRKCF
LSTVYNYTIFSVYCIYFTDYLQILIKIYLLALYEFIN
Download sequence
Identical sequences GS_04568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]