SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_04744 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_04744
Domain Number 1 Region: 415-619,711-750,876-964
Classification Level Classification E-value
Superfamily TPR-like 1.9e-60
Family Tetratricopeptide repeat (TPR) 0.00014
Further Details:      
 
Domain Number 2 Region: 72-371
Classification Level Classification E-value
Superfamily TPR-like 1.56e-56
Family Tetratricopeptide repeat (TPR) 0.0000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GS_04744
Sequence length 1100
Comment GS_04744 GS_04744
Sequence
MDPSKPQSYFIHPAAYDPAALAGAKLQVMANSPLAVVAAVQKAQQQHVAATLANALVPPA
VNVVDIAALTELAHREYQAGDYANAEQHCNAIWRADQNNVSVLLLLSSIHFQLKNLDKSM
QFSSMAIKANPNCAEAYSNLGNVYKERNQLAEALENYRIAVRLKPDFIDGYINLAAALVA
GGDLEQAVSAYLSALQYNPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWS
NLGCVFNAQGEIWLAIHHFEKAVQLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLA
GNHAVVHGNLACVYYEQGLIDLAIDMYRKAIELQPNFPDAYCNLANALKEKGLVEEAEKA
YNTALALCPTHADSQNNLANIKREQGKIEEATRLYLKALEIYPEFAAAHSNLASILQQQG
KLQDAINHYKEAIRIAPTFADAYSNMGNTLKEMGDIGGALQCYTRAIQINPGFADAHSNL
ASIHKDSGNIPEAIQSYSTALKLKPDFPDAFCNLAHCLQIICDWTDYDNRMRKLVAIVEE
QLEKKRLPSVHPHHSMLYPLTHAARMAIAAKHAQLCLEKVQIFHRAPYSFPDRASVRKGH
RLKIGYVSSDFGNHPTSHLMQSIPGMHNRESVEVYCYALSVNDGTNFRQKLMNESEHFVD
LSLIPSNDKAADRIHDDGIHILINMNGYTKGARNEIFAMRPAPIQVMWLGYPGTSGAPFM
DYIITDSVTSPLELAHAYSEKLAYMPHTFFIGDHAQMLKHLTERVILKEKNDTTPLDKDT
VTVVNSVNLEPLLSKADVKPFVRETEVAHGPDRDMIKTEVVLPVIEVPTTEPLKQMIGSG
MIAGNVEGVPVQNGLTTLNQTHVKAATGEEVPHTILVTSRQQYGLPEDAIVFCNFNQLYK
IDPSTLTMWCEILKLVPNSVLWLLRFPFHGEANVIRFCAERGIDARRVVFSNVAAKEEHV
RRGQLADVCLDTPLCNGHTTGMDILWTGTPMITMPLETLASRVASSQLVALGVPELVAKD
REDYIRIAARLGTDREYLSQIRAKVWKARTTSTLFDVRQYCADMEQLLHRMWRRYAEGLP
PDHILSDRDVARESGDLKNL
Download sequence
Identical sequences F1KT35
GS_04744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]