SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_11225 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_11225
Domain Number 1 Region: 103-157
Classification Level Classification E-value
Superfamily EF-hand 0.0000000325
Family Calmodulin-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GS_11225
Sequence length 158
Comment GS_11225 GS_11225
Sequence
MQNAIHDNESINFNVFTALLGSSILLYLTKFCADDFIHEDSRPSISTAIFFSLLMQKSRS
LQSYAYVIRHCCTIVTRYHIEYCSVFDCSQQLHDDNRIMASSEQLMAAFKRADADGSGTL
DREEARKAFADLKEYAKFSDFDTEFDKIAVDGIITFER
Download sequence
Identical sequences GS_11225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]