SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_14169 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_14169
Domain Number 1 Region: 134-186
Classification Level Classification E-value
Superfamily RING/U-box 2.5e-18
Family RING finger domain, C3HC4 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GS_14169
Sequence length 195
Comment GS_14169 GS_14169
Sequence
MNVSPLFDYARFIVEFAASNSRKYCYIEVVACIPPAILSNKRRLRRIYQWMEYTSQLYRY
LLPIQRWYLYLNDKQSSSLAVYYFDVVLVVLYIIYKILIFRMPLTRWLHSTRYICRLTSI
GSVPSLAELATYPQCTICFSEVTGPLKLPCGHVFCEQCIGTWLDNENTCPNCRAVITLED
NAWKNGDTSYLPQFC
Download sequence
Identical sequences GS_14169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]