SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_15536 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GS_15536
Domain Number - Region: 22-67
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0012
Family GntR ligand-binding domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GS_15536
Sequence length 74
Comment GS_15536 GS_15536
Sequence
MTDIYVYLLPYISVDFSEEELGRTPPAGDWAEYRDLSERLWVLLKNCSSNRMLVDALQIV
WNALRSGYKNTMVI
Download sequence
Identical sequences GS_15536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]