SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_18063 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_18063
Domain Number 1 Region: 7-291
Classification Level Classification E-value
Superfamily TPR-like 1.14e-66
Family Tetratricopeptide repeat (TPR) 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GS_18063
Sequence length 293
Comment GS_18063 GS_18063
Sequence
MAENEAKARKKLEEAEKKARGGGGFLGSLFGGSKADEAADLFVQAGNLFKISKLWKEAGD
AFVRSAEIHAASNDGRHDTASNYAEAANCYRKVNPQLAVDCLMKTAEIYTDMGRFNMAAK
NHCTIAELYENECPDMAQCIAHYQKAADYYKGEESKSSATKCLIKVAQYAAQLEQYRKAI
QVFEEIATWEADHPTLKYAAKNHFFQALLCHLCIDVLDTQHALKRYEEISPSFVDTREYK
LICDLIACIEEHNQDHFTDTVKAYDKISRLDSWHTALLVKIKRSCGEEEDDLK
Download sequence
Identical sequences GS_18063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]