SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_18910 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_18910
Domain Number 1 Region: 132-225
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-17
Family SH2 domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GS_18910
Sequence length 240
Comment GS_18910 GS_18910
Sequence
MADARCETDEAHYDIPWEFIHRTASFPAQNERSQSQSADSFSSKRVDTALCASSKHTNGG
SDPRRHSRTRPVRVTASPNPSNGKAHRASCGSPTDKVVAQSSNAEVDRTRLKLNLDDLRE
RLNETGVTRRERYREEELVHHGVDRLEAERRLLNCRIGSFLVRMRDNGSLALSIRANKGI
LHIKLELRDNRWVLGEGPSFGSVATVVSFYRSHELPIRGAERMLLSSPLLVSPANSRPLV
Download sequence
Identical sequences GS_18910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]