SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_20412 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_20412
Domain Number 1 Region: 163-485
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 8.63e-107
Family Protein serine/threonine phosphatase 0.00000000264
Further Details:      
 
Domain Number 2 Region: 21-153
Classification Level Classification E-value
Superfamily TPR-like 2.11e-28
Family Tetratricopeptide repeat (TPR) 0.000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GS_20412
Sequence length 492
Comment GS_20412 GS_20412
Sequence
MTSEHVVSTVLDSLDGITNPSEKALRIKDEANQFFNDQAYDVAIDLYTKAIELDGAVAVL
YGNRSVAYLKKELYGSALEDAATALSLDPGYIKGYYRRATANMALGKFKLALKDYDAVRK
ARPSDKDAMRKFEECQKIIRRKAFEKAISMDHDRRSVADSINIDAIEVEASYDGPVLEDP
VSAEFMVELIRTFKAQKKLHKKYAYKILLEIRRLLGDQPTMVEIDVPAGQKFTICGDVHG
QFYDLCNIFDLNGLPSEENPYLFNGDFVDRGSFSVETIFTLFGFRLLYPNHFFMSRGNHE
SEVMNKMYGFEGEVRSKYTSQMADFFTEIFNYLPLCHLINKKIFVCHGGLFKDDNITLDE
IRSTNRDRQPPDEGVMCDLLWSDPQDLPGRSPSKRGVGCQFGPDITEDFCKRNGLDYVIR
SHEVKPEGYEIHHGGKCVTVFSAPNYCDTMGNKGAFITIRGNNLRPRFTSFSAVEHPSVR
PMAYASSLFGFA
Download sequence
Identical sequences GS_20412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]