SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_23459 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GS_23459
Domain Number - Region: 246-305
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0602
Family GntR ligand-binding domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GS_23459
Sequence length 387
Comment GS_23459 GS_23459
Sequence
DFPLVTVTNNQLISDATFSQQPYNDVERLPPNNTFGYTWPIPLYWKNYRYYYKNNETSLT
WLNPAYETCAKSAIAPNNRAIHWDMGNAESTSYLRVDYDDIGYTRLLEQLKARRDIDFST
ADKVHLIGDQLAIATERDRNGLPFSYHKVLDLITTILPKYPHYATFKIAQDFIDSMERLF
MDGPDYELFKAGIRRWLEENYNILGYNTTGNWNNDMARYLMLPYAVRYEVGTSAEEGLKL
FNQFLVDCSNTTTVIDDCSHVHPDIRIAVYCSGIRHGPQESFDRLLTLYDLQEKNAYYFY
HEYYAMLQGLSCSPRREDIMKVIPRSLKVFRMPPSKKYFVPTLFFIVAFPSGSQWMAEYL
EANANEVMSSVNFDEYLDAMTSAWYSE
Download sequence
Identical sequences GS_23459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]