SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_23802 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_23802
Domain Number 1 Region: 563-673
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000575
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GS_23802
Sequence length 677
Comment GS_23802 GS_23802
Sequence
MVLNNNDKPNELNRCHNWSTFVESQSVEVAKSADFRSLDSRESFDKRAIEMMRCPCGIGH
NNNAHRNCVRAGKVYPYAMSGTKYAAKAFKGMNDAQRYEHHYYDTPANEMCGSEDIQKGG
MNDEGEHERIFTSCAYFNASSSVRYANDVKIRRSCVANGNERKHRSADYGATVTVDGGTT
RNVADMDGLAALTSKTALCRGFPSEDNRSITVATPVRYSPATFSSPPPAGERVAVYERKE
TGNLLQSKRDAVTRDPVATSTPVDGSPPTMVHSVGDSPSRMLNRSGISTITASTICDPNF
EQDYVAEIKRLNEGILIQEERLSQAIVALAHAKNFSSNYGTLAELCAHRELLLCRERHAV
FHRELERVKMLHLIKKRIPQLSPKMQSTFEVLSIVVHLNRNFSIRSSGERDAYAFLALLK
AADQVDATEAVTPIGGRTMRVNTVQFNGRILFTNMPLDFTVTVEIYALKMYETKRQDDRH
CAVLKNKAKSLLNPNICVGKQSMNDESVVSSSEFTLCGRVLLNRDTVGTQRFYLENVEYP
LEGTIELKSSCTPVPAIIETGFNGFLTMYEVVSDLASWVRYWAVLRRGVVRFWKYPDDEA
AEKTAIADMDLTKCTNVKVKPASFEVCFHPNAFCVDLLLSTRPSVVEKKRVLLSADTKEQ
CVAWIDAINETLALLRG
Download sequence
Identical sequences GS_23802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]