SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_01820 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_01820
Domain Number 1 Region: 787-893
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000192
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GS_01820
Sequence length 899
Comment GS_01820 GS_01820
Sequence
MSDVEPAVDELQIRVNFMRSEIPCHDQEELEHAVDGERHADAAYRHPYKEVFVTQSPEVK
SRAVSVLNKMLQLRSGRASESGMSGRSRLNDSSALNDCTLNRCLPAYEKLARPPTAMSLT
SACDLKAGNEGGDTVDLTNSVLSDGRSTIRERVPRGQTRHLASMFETLADVAVSEVTLGR
FDVERMSWSKRNKSVPPPTATGRNHQQSTSRTTLTQKSAAKMTEDDFFLLAHNFRGENRF
ANGTPLHLKVFYEKERCYENGDANRVTDHLPYMKDVVVGKVRFITNQFENASAKVSDSVA
ADSQSRGNPRRLAAPNILSPSVQRLRNECSRKCSCVITNPSSRPAAGCGAIDLTDNDYKD
RLTPVTEGSFEQRNSRYTSASQQVMPHGKCERLQGGRMRENKDELCYMCKGINLKTESSN
TSVISEESLFDGHRSRGCRECTVAHMRELRSDTNMVQDIAESNSVYSFTENERSRLVEVA
RNMQMIGSTVHSALSAPVSQAPHTCDTSLPSYSPCCSGRSMSVASDISEISDERNNTLQI
KRVSEELLVQKERLSRALAAVTKCRKKNNFTGTLAEICAQREFILCYERDVVLRQHLERL
KTRRFNKVTLPRLSRKVRTSLDIHSIAVYLDHEVYTKNANGANSYAFVAVLKSDEYVKAT
EAVTVVCSNSMKINAVHFKNHIHFVGLPLNFVISIHIHAMRVHEGEHANKYSGVVMKNNA
AKSIMPPYAMNSINSSLEFVCCGSLLLNRDAVGVRRLHMEDFIYPLEGTIELKSRCTALP
PLIETAFRGFLTVCEGEGEWVRYWSVLRSGMLHFWKCLDDEASDKRSVINVDLTKCVDKK
VVPLSRGLFPCPSNTFGLNLLIEAASVSEIKRVLLSAETKEVCAAWIDAINETLDVLRA
Download sequence
Identical sequences GS_01820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]