SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_07849 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_07849
Domain Number 1 Region: 126-236
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000767
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GS_07849
Sequence length 242
Comment GS_07849 GS_07849
Sequence
MDSRVMRVSSVKFNEPIRFTNLPVDLAVSLEIYALKVHEVRSRIVDDRSCAKLRNRARTL
LSPLRKANVDTSIVNSSQFTLCGSVVLNREAVGTQRFYLDNAEYPLEGTVEVRSTCAALP
PIIETTFRGFLTMYEVISDLGSWARYWAVMRRGVVYFWKYPDDEAAEKPALAFMDLTSCI
DKRIELAAIEVCSRPHTFSLDLLVPSPSTAMDKKRVLLSADTKEQCIAWIDAINETLEIL
RA
Download sequence
Identical sequences GS_07849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]