SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_08406 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_08406
Domain Number 1 Region: 234-262,307-507
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.59e-50
Family Voltage-gated potassium channels 0.00053
Further Details:      
 
Domain Number 2 Region: 87-192
Classification Level Classification E-value
Superfamily POZ domain 7.06e-20
Family Tetramerization domain of potassium channels 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GS_08406
Sequence length 528
Comment GS_08406 GS_08406
Sequence
MIPSQMASGGAVIAIREAEEASARDSINREEASYIYRKYSNEGASLDHDSSISRFANNTL
SDDVEARLPSKKNLEQKANIRATDVQDTILRLNIGGSSYRIRTRSIIKFGPMTLLGRFVR
MNHEHRRQWADWYFEESDEYFFERVPRYFDPIYDFYATGRLHVPKDLCFDKFMAELRFWA
VSKSKMDECCSPFAQYCILPKAASESSEKDYFIGLRCAKIRRRLWYVLEGQTSSRWWKAF
EITSTSFVVLSIAALILGSIPEFQVPEGPKGGVSTTQSSLTYPTYSKADGRAISPKVGSR
NPDDLGPEMIEHPVFNYIENICVIYFTLEYIVRFTVAPRKWPFVRDFLNVIDLLAIAPFI
FELVLIVVGISGENVRKVRWAFLTVRLLRVLRVVRIAKLGRFSPGLANFALTIRKSKKQM
QMVAIVMLTVVVFFSTLVYFLEKDEPKTTFTSIPASFWWAVVTMSTVGYGDSVPQTVAGK
LIGSGAIVCGVMVLALPITIMVNNFMQVVKLREEKIIKKYAQQHGDQV
Download sequence
Identical sequences GS_08406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]