SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_13040 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_13040
Domain Number 1 Region: 234-286
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000275
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 206-236
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000706
Family Somatomedin B domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GS_13040
Sequence length 430
Comment GS_13040 GS_13040
Sequence
MLMFHIIFAFYMVGKVQAGCYQKRLCCPGRNLSCTAIDDGIEHLPLRPFVRQMTPTKTTT
TSTTSTPTTTSSGDQVHSPRLYDEQMQRIEHIVHPDIIDLEGSGNELYDKYGERIQLDAV
SIEPMEVVELGTTIAPAFKRIVFGEAFFPLEQPFEITRTRRDGLPRNANDDQYSLLNQHL
PISVGDITDYDDESNVSKYIYLESSHENRCYCDEICTTFGDCCSDYTFVCPPSDCYLTNW
SDWSPCIADDNERKCGSGVKTRVREIRRGPRFGGAECPPLVEKISCFEECHRQTEDITTV
ALLLDYQYNKIREKLARDNIYWDLPEVASKIEKLSYYCVTYEIGWVNQNCVDKKVTTKLY
KGNVICAECQPEAQLHRNNMRCASDLNDDEYGLWKFIGAKSCNGIWRRISRSDNCKCEHN
YPTNVSFLLV
Download sequence
Identical sequences GS_13040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]