SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_15639 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_15639
Domain Number 1 Region: 96-189
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000082
Family Phosphotyrosine-binding domain (PTB) 0.0089
Further Details:      
 
Weak hits

Sequence:  GS_15639
Domain Number - Region: 41-69
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00349
Family SAM (sterile alpha motif) domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GS_15639
Sequence length 198
Comment GS_15639 GS_15639
Sequence
MEKDSVKCKYEDAFIGGRTEREVGVPYRHLDRGTSEETTESLLAFSLGITLLGHQRRILN
SLKEAKAERRQRATERVNAALHDDETDSGQESRSTAQSSSTSTQKPHSIIIGGRQTEWRH
SSTTLIEDCVSYSAHYLGSMEISNVEGTEDSRRAMVKLKKGIREIAKVPQVVLEISVAGV
RVLDATTKVNTSALLTAS
Download sequence
Identical sequences GS_15639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]