SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_16278 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_16278
Domain Number 1 Region: 213-244,273-472
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.37e-52
Family Voltage-gated potassium channels 0.00051
Further Details:      
 
Domain Number 2 Region: 72-176
Classification Level Classification E-value
Superfamily POZ domain 1.7e-18
Family Tetramerization domain of potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GS_16278
Sequence length 504
Comment GS_16278 GS_16278
Sequence
MRFKRFRVTGNMISGAAQQHKKRLVPLRKTDAMSSAERRNAKILDEIWKSGMDCFQVVPA
GGIGVDGEPMFLKLNIGGTGYLLLVDAILRAEPSGFLAKFVQLNHATRLKVADAYIASED
SYYFQRSPYAFDAIFQYYATGVIHRPPEICPAAFLSELDFWRISHQHVGSCCADILPRDK
SEEKEEEKVDDTTFDNLMFGRIRRRMWTFLEKPGSSMQAKAFELSSTLFVAISVMGLSFG
TIPDFQVTHYMPPHNETIVLPNGTVTVIEKVEEMRVEHPAFVFTERICIAFFTVEYCLRI
FAAPRKIRFALKPLNLVDLMAIVPFYLELLLTLCGVDDKKLRDLRWAFLVVRILRVLRVI
RIIKLGRFSSGLQTFGMTLQRSQKQLQMMTIVLLTGVVFFSTMIYFLEKDEDGTPFTSIP
AAYWWCIVTMTTVGYGDAVPATTMGKIIASAAIMCGVLVLALPITIIVDNFIKVAQDEQQ
AEQAKGEITRQEQAIQSMLHRNDD
Download sequence
Identical sequences GS_16278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]