SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_17140 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_17140
Domain Number 1 Region: 184-306
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-24
Family Ran-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  GS_17140
Domain Number - Region: 35-76
Classification Level Classification E-value
Superfamily GTP cyclohydrolase I feedback regulatory protein, GFRP 0.0144
Family GTP cyclohydrolase I feedback regulatory protein, GFRP 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GS_17140
Sequence length 337
Comment GS_17140 GS_17140
Sequence
MAAKKPFVFKSSKLSTAADQLWTASKSEFKPTTTATAIKLDLGKTLVDDKVSAAKLNADL
ASKKGFVFGSKLTERVIVDAKGENCFFLFSFIRFAMNVKYKVVEKREESNDQKKGQNGDG
DGAPKTVSAVFEEIQKKGTTSSFLAGDRNQYEEEGASTSSKLKESAEEAESQRRESTNAL
SKSAEEVDISTGEENEVNVCHVMCKLHSFELTSKSWHDRGMGSLRINRCDESTSPQYRIV
GRITGNQRVVLNSRIFADMVLEKVSTRRLKFSATTPDSELPVLFLATASEFVTEQLYSTL
AGIIEKKKEEDGSRKRKASDASTEQDDDGVQPKKTPT
Download sequence
Identical sequences GS_17140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]