SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_18436 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_18436
Domain Number 1 Region: 9-132
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.32e-47
Family N-terminal domain of cbl (N-cbl) 0.0000121
Further Details:      
 
Domain Number 2 Region: 220-306
Classification Level Classification E-value
Superfamily SH2 domain 1.66e-44
Family SH2 domain 0.0000105
Further Details:      
 
Domain Number 3 Region: 312-391
Classification Level Classification E-value
Superfamily RING/U-box 3.14e-37
Family RING finger domain, C3HC4 0.0000393
Further Details:      
 
Domain Number 4 Region: 135-219
Classification Level Classification E-value
Superfamily EF-hand 4.49e-32
Family EF-hand modules in multidomain proteins 0.0000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GS_18436
Sequence length 484
Comment GS_18436 GS_18436
Sequence
MECFILSYLQDRRAIEKTFKLMDHVVKQCQQPRLNLKNSPPFILDILPDTYHQLTQIFVK
DPNCLRENIYLQLFLENVQAKCKQTLKLFKEDRDRIFDERSSSRRNLTKLSLIFSHMLAE
LKAEFPDGHFIGENFRITKKEADAFWKKSFGSKTTVHWLEFRSALNKVHKLNTGLETLAL
KSTIDLTVNEYISNFEFDVFTRLFQPWCTLLRNWQLLAVTHPGYVAFLTYDEVKQKLQKY
TNKPGSYVFRLSCTRLGQWAVGYVAPDGKIYQTIPQNKSLIQALVDGSREGFYRYPDGRP
VNPDLTHALQPTPEGHLKVTPEQYQIYCEMGTTFEMCKICAENNKNVKLEPCGHLLCTPC
LQSWQESDGGSTCPFCRCEIKGTEKVIIDSFDSAETKKRAGYETLIDANTMENRQTWPPQ
TDIGPPRLAPPPLPPRRESPSEGSTPSMSHRHIAPTMNTLDSGKPMSVAPELSRPSVMLP
VCSP
Download sequence
Identical sequences GS_18436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]