SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_18509 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_18509
Domain Number 1 Region: 52-136
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000051
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 296-394
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000288
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.022
Further Details:      
 
Domain Number 3 Region: 134-259
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000524
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GS_18509
Sequence length 461
Comment GS_18509 GS_18509
Sequence
MATGSSQAPTFIDPWQHGASEEDDLGVSMSKYARMEVGEGEEGNDTKERFARENHSEIER
RRRNKMTHYINELAEMVPQCAALGRKPDKLTILRMAVSHMKAIRGTSQTGTEASYKPSFL
TDQELKHLILEAANGFLFVVCCDTGRVLYVADSIVPVLNVRQEDWLHHPIYELIHPDDME
KVRDQLCGSDASLNRVLDLKTGTVKKEQGSVRVHMSCRRGFICRMRLGPLEQLHRLCNRR
PLFTHNGHHYVVVHCTGYVKNSPPGGLDAPPSSCLVAIGRLQVASMSISTDLGSPPQFSL
RLAEDGKITFVEQKASSLLSIPTEQLLGRYWWEIVHPSDEQALHEVFVHIMQDQPAHITV
RVRTQRDLVFCSISASKFVNPYSEQFEYIVATHMLVPPSDEGWQANSQVFQHGPQNAEFD
PSAAGDWSAASGFTTDGLLPLSRRQATWPEQWNTAEQFAQR
Download sequence
Identical sequences F1L4P1
GS_18509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]